KEGG   Trichodesmium erythraeum: Tery_0165Help
Entry
Tery_0165         CDS       T00387                                 

Definition
(GenBank) DNA recombination protein, RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ter  Trichodesmium erythraeum
Pathway
ter03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ter00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tery_0165
Enzymes [BR:ter01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tery_0165
DNA repair and recombination proteins [BR:ter03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Tery_0165
    RecFOR pathway proteins
     Tery_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5
Motif
Other DBs
NCBI-ProteinID: ABG49659
JGI: Tery0165
CyanoBase: Tery_0165
CYORF: Tery_0165
UniProt: Q11A15
Position
248855..249184
Genome map
AA seq 109 aa AA seqDB search
MINYLKGKVANVYKGSGFRMTVILEVNQVGYELQVLPRLTQSLQEGKQVQVFTHQQMRED
QMVLYGFGTSAERDLFRQLVSVSGIGAQLAIALLDTLCDLLATKPLIRI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgattaactatctaaaaggcaaagtggcaaatgtgtacaaaggcagtggttttcgtatg
actgtaattttagaggttaatcaagtaggttatgagctacaagttctacctcgtttaact
cagagtttacaggaagggaagcaggtgcaagtttttactcaccaacaaatgcgagaagac
caaatggtcttgtacggttttggtacttcagctgaaagagacttatttcgtcagttagta
agcgtaagtggtattggggcacaattagcgatcgctctattagatactctgtgcgacttg
ttggccactaaacctttaattaggatataa

DBGET integrated database retrieval system