KEGG   Trichodesmium erythraeum: Tery_0165Help
Entry
Tery_0165         CDS       T00387                                 

Definition
DNA recombination protein RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ter  Trichodesmium erythraeum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ter00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tery_0165
Enzymes [BR:ter01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tery_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_0165
CYORF: 
UniProt: 
Position
248855..249184
Genome map
AA seq 109 aa AA seqDB search
MINYLKGKVANVYKGSGFRMTVILEVNQVGYELQVLPRLTQSLQEGKQVQVFTHQQMRED
QMVLYGFGTSAERDLFRQLVSVSGIGAQLAIALLDTLCDLLATKPLIRI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgattaactatctaaaaggcaaagtggcaaatgtgtacaaaggcagtggttttcgtatg
actgtaattttagaggttaatcaagtaggttatgagctacaagttctacctcgtttaact
cagagtttacaggaagggaagcaggtgcaagtttttactcaccaacaaatgcgagaagac
caaatggtcttgtacggttttggtacttcagctgaaagagacttatttcgtcagttagta
agcgtaagtggtattggggcacaattagcgatcgctctattagatactctgtgcgacttg
ttggccactaaacctttaattaggatataa

DBGET integrated database retrieval system