KEGG   Trichodesmium erythraeum: Tery_0165Help
Entry
Tery_0165         CDS       T00387                                 

Definition
DNA recombination protein RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ter  Trichodesmium erythraeum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ter03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_0165
CYORF: 
UniProt: 
Position
248855..249184
Genome map
AA seq 109 aa AA seqDB search
MINYLKGKVANVYKGSGFRMTVILEVNQVGYELQVLPRLTQSLQEGKQVQVFTHQQMRED
QMVLYGFGTSAERDLFRQLVSVSGIGAQLAIALLDTLCDLLATKPLIRI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgattaactatctaaaaggcaaagtggcaaatgtgtacaaaggcagtggttttcgtatg
actgtaattttagaggttaatcaagtaggttatgagctacaagttctacctcgtttaact
cagagtttacaggaagggaagcaggtgcaagtttttactcaccaacaaatgcgagaagac
caaatggtcttgtacggttttggtacttcagctgaaagagacttatttcgtcagttagta
agcgtaagtggtattggggcacaattagcgatcgctctattagatactctgtgcgacttg
ttggccactaaacctttaattaggatataa

DBGET integrated database retrieval system