KEGG   Trichodesmium erythraeum: Tery_0416Help
Entry
Tery_0416         CDS       T00387                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ter  Trichodesmium erythraeum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tery_0416
Enzymes [BR:ter01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tery_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_0416
CYORF: 
UniProt: 
Position
652887..654566
Genome map
AA seq 559 aa AA seqDB search
MTNESYSGIVDNFLKTNNMKPITILGSTGSIGTQTLNIVAHNPNKFRVIGLAAGSNVEIL
AQQVRQFCPQIVAINDKSKFRELQEAIADLQPQPILVADQDGVIQVARYGESEVVVTGIV
GCAGLLPTIAAIEAGKDIALANKETLIAAGPVVNPLIEKYRVKLLPADSEHSAIFQCLQG
LPLEGLRRIILTASGGAFRDWPIEKLSKVKVADAIKHPNWSMGKKITVDSATMMNKGLEV
IEAHYLFGLNYDNIDIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYT
DWKQLDLVKAGSLTFKEPDNLKYPCIQLAYTAGRMGGSMPGVLNAANEQAVALFLEEKIA
FLDIPKLIEYVCEKHNSNYQENPSLDDILAADKWARKEVLAASSIVNNSLINLSLVNLEE
NPTEIFTKIENEQIEFNDFYQRGLAKYEQQDYQSALAEFDRAIDIDSSHIDAYIYRGDAK
DKLEDYEGAIADYNEAIKIDSSHPKAYYSRENVLRKAGDSREAIADYDQAIKLDPNYTPT
KNWSHVHVNSETTEKLRQE
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgaatcgtatagtggaattgtggacaatttcctaaaaacaaacaatatgaaa
ccaattacaatcttaggatctacagggtctattggtactcaaactttgaacattgtggct
cacaacccaaacaaatttcgagttattgggttagctgctggaagtaatgtagaaatatta
gcccaacaggtcagacaattttgccctcaaattgttgctattaatgataagtccaaattt
agggaactacaagaggccattgctgacttgcagcctcagcctatattggttgctgaccaa
gatggtgttatacaagtagctagatatggggaatcagaagtagtcgtaactggtattgtt
ggttgtgctggtttattgcctactattgctgctattgaagcaggcaaagatattgcttta
gcaaataaagaaacacttattgcagcaggtccagttgttaatcctttaattgaaaaatat
agagtcaaattattaccagcagactcagaacattcagcaatttttcaatgtcttcaaggt
ttaccattagagggtttgcgcagaattattttaactgcttctggtggtgcttttcgagat
tggccgattgagaaattatcaaaagtaaaagtggcagatgctattaaacatcctaactgg
tcaatgggtaagaaaattaccgttgattctgctacaatgatgaataaaggtttggaagtt
attgaagctcattatttgtttggattgaattatgataatattgatatagtaattcatcct
caaagcataattcactctttaattgagttacaagatacttctgttttagctcaactaggt
tggccggatatgcgtttgcctttgctttacgctttatcttggccggaaagaatttatact
gattggaaacagttagatttagttaaagctggaagtttgactttcaaggaacctgataat
ttgaaatatccttgcattcagttagcttatacagctggtcgtatgggtggttctatgcct
ggagttttgaatgctgcaaatgaacaggctgtagcattgtttttagaagaaaaaatagca
tttttggatattccaaaattgattgaatatgtctgtgaaaagcataattcaaattatcaa
gaaaatcctagtctagatgatattttggcagcagataaatgggcaagaaaagaggtttta
gcagcaagtagtatagtaaataattctctaataaatttaagtttggttaatcttgaggaa
aatcccacagaaatatttacaaaaatcgaaaatgagcagatagaatttaatgatttttat
cagcggggattagctaaatatgaacaacaagattatcaatcagctttagcagagtttgat
cgagcaatagatatagactccagtcatatagatgcttatatttataggggtgatgctaaa
gataaattagaagactatgagggagcaattgctgattataatgaggcaattaaaatagat
tcaagtcatccaaaagcttattatagtcgggaaaatgtactgcgaaaagctggagatagt
agggaagcgatcgctgattatgatcaagcaattaaactagatccaaattatacacctacc
aagaattggagtcatgttcatgttaactcagaaactacggaaaagttacgacaggagtaa

DBGET integrated database retrieval system