KEGG   Trichodesmium erythraeum: Tery_0581Help
Entry
Tery_0581         CDS       T00387                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tery_0581
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tery_0581
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tery_0581
Enzymes [BR:ter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tery_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_0581
CYORF: 
UniProt: 
Position
932940..934169
Genome map
AA seq 409 aa AA seqDB search
MTITPLNPTSTQQPDSLGRFGKFGGKYVPETLMPALLQLETACKKYSQDPTFKQELQQLL
RDYVGRPSPLYFAERLTAHYTKPDGTGPQIYLKREDLNHTGAHKINNALGQALLAQRMGK
QRIIAETGAGQHGVATATVCARFGLKCVIYMGIHDMERQALNVFRMRLMGAEVRPVEAGT
GTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGVETRAQCLEKWNGL
PDILMACVGGGSNAMGLFHEFINDPSVRMIGVEAAGKGVDTNKHAATLTLGRVGVLHGAM
SYLLQDEEGQIIEPHSISAGLDYPGVGPEHSFLKDSGRVEYYSVTDNEAVAAFQRLSQLE
GIIPALETAHAIAYLETLCPQLSGSPRIVFNCSGRGDKDVQTVGKFLEG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgactattacacctctaaatccaacttccactcaacaaccagattctctaggcagattt
ggcaagtttggcggtaaatatgtcccagaaacattaatgcctgccctattgcagctagag
acagcctgtaaaaaatacagtcaagaccctacttttaaacaagaacttcaacaactatta
cgagactatgtaggtcgccctagccctctttacttcgccgaacgtttgacagctcattac
accaaacctgatggtacagggccacaaatttacctgaaaagggaagaccttaaccataca
ggagcccacaaaatcaacaatgctctaggccaagccttattagcccagagaatgggcaaa
caacgcattattgctgaaacaggtgcaggtcaacatggtgtggccaccgctacagtttgc
gctcggtttggcttgaagtgtgtcatttacatgggcattcacgacatggaacgtcaagct
ctaaatgtattcagaatgcgactgatgggggcggaggtgcgaccagtagaagctggcacc
ggtaccctcaaagatgcaacttcggaagctattcgcgactgggtgactaatgtggagaca
acccattatattctaggctccgttgctgggccccatccttacccaatgatggtgcgtgat
tttcatgctgtcattggggtcgaaacccgcgctcaatgtttggaaaaatggaatggtttg
cctgacattttgatggcttgtgttggcggggggtctaatgccatgggattattccatgag
tttattaatgatccgtcggtgcggatgatcggtgtggaagctgctggtaagggagttgat
acgaataagcatgctgcgactctgactcttggtcgagtaggtgtgttgcatggggcaatg
agttatttgttgcaggatgaggaaggtcagataatagaaccccactctattagcgctggt
ttagattatcctggagtaggacctgagcatagctttttaaaggatagtggtagagtcgaa
tattatagtgtgaccgataatgaggcggtggcagcttttcaacgtttgtctcagttagag
ggtattattccagctttagagactgctcatgcgatcgcttatctagaaactctttgccca
cagttaagtggtagtccccgcattgtctttaattgctccggccgtggggataaagacgtg
cagacagtagggaagtttttggaggggtaa

DBGET integrated database retrieval system