KEGG   Trichodesmium erythraeum: Tery_0688Help
Entry
Tery_0688         CDS       T00387                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ter  Trichodesmium erythraeum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ter00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_0688
CYORF: 
UniProt: 
Position
1124315..1124830
Genome map
AA seq 171 aa AA seqDB search
MSNPTNLKNSPKNQGHVAIGMGSNLGESLDTLKNAIQTLDEIAGIKLITYSSWYRTKPIG
PPQPDYINGCALLKVELTPHKLLEVLLDVEQKFKRVRLEHWGPRTLDLDLILYDDLILDT
PNLQIPHPRMKERAFVLVPLAEIAPNWIDPVSGKAIALLQEEVECSGISKL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcctactaacttaaagaactccccaaaaaatcaaggccatgtagctattggt
atgggtagcaatttgggagaatcccttgatactctcaagaatgccattcaaactttagat
gaaattgctggtattaaattaattacttattctagttggtatagaactaaacctataggt
ccaccacaaccagattatattaatggttgtgcattattaaaagtagaattaacccctcat
aaattattagaagttctgttagatgttgaacaaaaatttaaacgggtacgtttagaacat
tggggacctagaactttagatttagatttaattttatatgatgatttaatattagatact
cctaatctgcaaataccccatcctcgaatgaaagaaagagcttttgtacttgtcccacta
gcagaaatagctcctaattggatcgacccagtttcgggaaaagcgatcgctcttcttcaa
gaagaggtagaatgttctggaatatctaagctgtaa

DBGET integrated database retrieval system