KEGG   Trichodesmium erythraeum: Tery_0688Help
Entry
Tery_0688         CDS       T00387                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ter  Trichodesmium erythraeum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tery_0688
Enzymes [BR:ter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Tery_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_0688
CYORF: 
UniProt: 
Position
1124315..1124830
Genome map
AA seq 171 aa AA seqDB search
MSNPTNLKNSPKNQGHVAIGMGSNLGESLDTLKNAIQTLDEIAGIKLITYSSWYRTKPIG
PPQPDYINGCALLKVELTPHKLLEVLLDVEQKFKRVRLEHWGPRTLDLDLILYDDLILDT
PNLQIPHPRMKERAFVLVPLAEIAPNWIDPVSGKAIALLQEEVECSGISKL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcctactaacttaaagaactccccaaaaaatcaaggccatgtagctattggt
atgggtagcaatttgggagaatcccttgatactctcaagaatgccattcaaactttagat
gaaattgctggtattaaattaattacttattctagttggtatagaactaaacctataggt
ccaccacaaccagattatattaatggttgtgcattattaaaagtagaattaacccctcat
aaattattagaagttctgttagatgttgaacaaaaatttaaacgggtacgtttagaacat
tggggacctagaactttagatttagatttaattttatatgatgatttaatattagatact
cctaatctgcaaataccccatcctcgaatgaaagaaagagcttttgtacttgtcccacta
gcagaaatagctcctaattggatcgacccagtttcgggaaaagcgatcgctcttcttcaa
gaagaggtagaatgttctggaatatctaagctgtaa

DBGET integrated database retrieval system