KEGG   Trichodesmium erythraeum: Tery_0774Help
Entry
Tery_0774         CDS       T00387                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tery_0774 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_0774 (glk)
   00052 Galactose metabolism
    Tery_0774 (glk)
   00500 Starch and sucrose metabolism
    Tery_0774 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Tery_0774 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tery_0774 (glk)
   00524 Butirosin and neomycin biosynthesis
    Tery_0774 (glk)
Enzymes [BR:ter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tery_0774 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_0774
CYORF: 
UniProt: 
Position
1238060..1239115
Genome map
AA seq 351 aa AA seqDB search
MTLLVAGDIGGTKTILQLVEVNREESKASVELRKLYENRYLSNDFPDLVPIVKKFLEEAS
EKLGEKQKPEKACFAIAGPVVNNIVKLTNLPWIIDAKLMENELGISQISLINDFEAVGYG
ILGLNTKDLETLQPGEPKSDTPIAVIGAGTGLGQCFLIRAAGVIKVYPTEGGHTDFKARS
QLEFDLLKYLKKLHNIKRVSVERVVSGMGIVAIYQFLRDSLFATESPEIGDQIRQWEKEV
GSNQITVDPGAVIGKAALEKSDPLCEQTLKMFIEAYGAEAGNLALKLLPYSGLYIAGGIA
AKIIPLINSGSFMEAFKDKGRMKPLLEKIPVHVILNPHVGLIGAAIRASNL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacattgttagttgcaggtgacattggtggtacgaaaactatactacaattggtagag
gtaaaccgagaagaatcaaaagcttccgtggaactacgtaaactttatgaaaatcgttac
ttgagtaacgattttcccgatttagtacctatagtaaaaaagttccttgaagaagctagt
gaaaaattaggagaaaaacaaaaacctgaaaaagcttgttttgccattgccggtccagtt
gtcaacaacatagttaaattgactaatttgccttggataatagatgccaaacttatggaa
aatgagttaggtatatctcaaattagtttgattaatgattttgaagcagtaggatatgga
attttaggtttaaatactaaggatcttgaaactttacaaccaggtgaacctaaaagtgat
actccaatagctgtaattggtgctggtacaggattaggacaatgttttttgattcgagca
gcaggggttattaaagtatatcctacagaaggaggtcatacagattttaaggcacgctca
cagttagaatttgacctattaaaatatttgaagaaattacataatataaagcgagtctct
gtagaaagagtagtttcgggaatgggaattgtcgcaatttatcaatttttacgcgatagc
ctatttgctacagaatctccagaaataggagatcaaattagacagtgggaaaaagaagta
ggttcaaatcaaattactgtagacccaggagcagtgatcggtaaagctgctttagaaaaa
agtgaccccttgtgcgagcaaaccttgaagatgtttatagaagcttatggggcagaagcg
ggaaatttggcactgaaacttttaccctatagtggtttatacatagcagggggtattgct
gctaaaattatcccacttataaattcaggtagttttatggaagcttttaaggataaaggg
cgaatgaaacccttattagaaaaaatacctgttcatgttattttaaatcctcacgtggga
ttaattggtgcagcaattcgtgcttctaatttatag

DBGET integrated database retrieval system