KEGG   Trichodesmium erythraeum: Tery_0774Help
Entry
Tery_0774         CDS       T00387                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00010  Glycolysis / Gluconeogenesis
ter00052  Galactose metabolism
ter00500  Starch and sucrose metabolism
ter00520  Amino sugar and nucleotide sugar metabolism
ter00521  Streptomycin biosynthesis
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
ter01120  Microbial metabolism in diverse environments
ter01130  Biosynthesis of antibiotics
ter01200  Carbon metabolism
Module
ter_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_0774
   00052 Galactose metabolism
    Tery_0774
   00500 Starch and sucrose metabolism
    Tery_0774
   00520 Amino sugar and nucleotide sugar metabolism
    Tery_0774
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tery_0774
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tery_0774
Enzymes [BR:ter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tery_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABG50198
JGI: Tery0774
CyanoBase: Tery_0774
CYORF: Tery_0774
UniProt: Q117X6
Position
1238060..1239115
Genome map
AA seq 351 aa AA seqDB search
MTLLVAGDIGGTKTILQLVEVNREESKASVELRKLYENRYLSNDFPDLVPIVKKFLEEAS
EKLGEKQKPEKACFAIAGPVVNNIVKLTNLPWIIDAKLMENELGISQISLINDFEAVGYG
ILGLNTKDLETLQPGEPKSDTPIAVIGAGTGLGQCFLIRAAGVIKVYPTEGGHTDFKARS
QLEFDLLKYLKKLHNIKRVSVERVVSGMGIVAIYQFLRDSLFATESPEIGDQIRQWEKEV
GSNQITVDPGAVIGKAALEKSDPLCEQTLKMFIEAYGAEAGNLALKLLPYSGLYIAGGIA
AKIIPLINSGSFMEAFKDKGRMKPLLEKIPVHVILNPHVGLIGAAIRASNL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacattgttagttgcaggtgacattggtggtacgaaaactatactacaattggtagag
gtaaaccgagaagaatcaaaagcttccgtggaactacgtaaactttatgaaaatcgttac
ttgagtaacgattttcccgatttagtacctatagtaaaaaagttccttgaagaagctagt
gaaaaattaggagaaaaacaaaaacctgaaaaagcttgttttgccattgccggtccagtt
gtcaacaacatagttaaattgactaatttgccttggataatagatgccaaacttatggaa
aatgagttaggtatatctcaaattagtttgattaatgattttgaagcagtaggatatgga
attttaggtttaaatactaaggatcttgaaactttacaaccaggtgaacctaaaagtgat
actccaatagctgtaattggtgctggtacaggattaggacaatgttttttgattcgagca
gcaggggttattaaagtatatcctacagaaggaggtcatacagattttaaggcacgctca
cagttagaatttgacctattaaaatatttgaagaaattacataatataaagcgagtctct
gtagaaagagtagtttcgggaatgggaattgtcgcaatttatcaatttttacgcgatagc
ctatttgctacagaatctccagaaataggagatcaaattagacagtgggaaaaagaagta
ggttcaaatcaaattactgtagacccaggagcagtgatcggtaaagctgctttagaaaaa
agtgaccccttgtgcgagcaaaccttgaagatgtttatagaagcttatggggcagaagcg
ggaaatttggcactgaaacttttaccctatagtggtttatacatagcagggggtattgct
gctaaaattatcccacttataaattcaggtagttttatggaagcttttaaggataaaggg
cgaatgaaacccttattagaaaaaatacctgttcatgttattttaaatcctcacgtggga
ttaattggtgcagcaattcgtgcttctaatttatag

DBGET integrated database retrieval system