KEGG   Trichodesmium erythraeum: Tery_0865Help
Entry
Tery_0865         CDS       T00387                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ter  Trichodesmium erythraeum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tery_0865
Enzymes [BR:ter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tery_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_0865
CYORF: 
UniProt: 
Position
complement(1369252..1370169)
Genome map
AA seq 305 aa AA seqDB search
MSIIIFGSVNIDLIATTPRLPTPGETINGNNFFTAGGGKGANQAVAAAGLGIPTKIVGRV
GNDSFGQQLLVSLSTANVDTTDVLVDENTHTGVAVIAVGASGENNIIVVPGANHSINNTD
VERLKNLLSDVTALLLQLEIPVEVAISAAKVAQEMGVKVILDPAPMPANFPNDFYNLIDI
ITPNEIEASQLVGFEVNNQETAMEAAVELCHRGVKNAVVKIGDRGVICATKEEAFFQPAF
VVKTIDTVAAGDAFNGGLAAALDTGLSLKEAVKWGAAAGALCTTKPGAQPAMPDRKTFDN
FLLKR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcataattatttttggtagtgtcaacattgacttaattgcaactactccccgttta
ccgactccaggagaaactattaatggcaacaacttttttaccgcaggtggcggtaaagga
gcaaatcaagctgttgctgctgctggccttggcattcccacaaaaatagtggggcgagtc
ggaaatgatagctttgggcaacaacttctagtcagtttgtccactgctaatgttgataca
acagatgtgttagttgatgagaatactcatacgggggtggcagttattgctgtgggtgct
agtggagaaaataatattattgttgttcctggtgctaaccatagtattaataatacagat
gtagaacgcctaaaaaatttgctatcggatgttacagctttacttttacaattagaaatt
cccgtggaagttgctataagtgcagcaaaagtagctcaagaaatgggggttaaagttatt
ctagatccagcaccaatgccagcaaattttcctaatgatttttataatttgattgacatt
attactcctaatgaaattgaggcaagtcaactggttgggtttgaagtaaataatcaagaa
actgctatggaggcagctgttgaattatgtcaccgtggtgtaaaaaatgctgtggtgaaa
ataggcgatcgcggagttatttgtgcaactaaagaagaagcattttttcaacctgccttt
gtagtaaaaacgatcgatactgtcgctgcgggcgatgcttttaatggtggtttagcagca
gcattagatacaggtttatcattaaaagaagctgttaaatggggggctgctgctggtgct
ttatgtactacaaaaccaggcgctcaacctgcaatgcccgatagaaaaacatttgataat
tttcttttaaaaaggtag

DBGET integrated database retrieval system