KEGG   Trichodesmium erythraeum: Tery_1015Help
Entry
Tery_1015         CDS       T00387                                 

Definition
(GenBank) Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase (EC:3.2.2.23 4.2.99.18)
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ter  Trichodesmium erythraeum
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ter00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Tery_1015
Enzymes [BR:ter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Tery_1015
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Tery_1015
DNA repair and recombination proteins [BR:ter03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Tery_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_1015
CYORF: 
UniProt: 
Position
1583042..1583944
Genome map
AA seq 300 aa AA seqDB search
MPELPEVEIVKQGLNQLTLNKRILGGEVLLERTLAYPISVADFLRGLEGKAIAQWHRQGK
YLLAQLYKWGKKNSKLQEYENEDGWLGVHLRMTGQLLWVNPEESLHKHTRVRLFFGHNSS
GDKDSSNYELRFVDQRTFGKMWGVPPGKEISKVITGLQQLGLEPFSPEFSPKYLNKKLYK
RHRPIKTALLDQTTIAGLGNIYADEALFLSGIRPTTICKDLTEKQIEQLHLAILKVLQTA
INAGGTTFSNFLNVKGVNGNYGGVAWVYSRAGQPCRICNTPLEKIKLAGRSTHFCPQCQK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaactgccggaagttgaaatagtaaaacaaggtttaaatcaactgactctcaat
aaaagaatattgggtggggaagtactattagaacgtacgcttgcttacccaatttctgta
gctgattttttgagagggttggaaggaaaagcgatcgcccaatggcatcgacaaggtaaa
tatttacttgcccaactttataaatggggcaaaaaaaactcaaaacttcaagaatacgaa
aatgaagatggttggttaggagtacatctacgaatgacaggccaactcttatgggtaaac
ccagaagagagtctgcacaaacacacacgagtaagattattttttggtcataactcttca
ggagataaagatagctctaattatgaattgagatttgtagatcaacgcacttttggcaag
atgtggggagtaccaccaggaaaagaaatatctaaagttataactggtttgcaacaactg
ggtcttgaaccattttctccagaattttctccaaaataccttaataaaaaactttacaaa
agacatcgaccaattaaaacagctcttttagaccagacaaccattgccgggttaggtaat
atttatgctgatgaagctctatttctcagtggtattagaccaacaactatatgtaaagat
ttgacagaaaaacaaatagaacaattacacctagccatacttaaagttttacaaactgct
ataaatgcaggtggtacaactttcagcaactttcttaatgtaaagggagttaatggtaat
tatggaggtgtagcttgggtttatagtcgtgctggtcaaccatgtcgaatttgtaataca
cctttagaaaaaattaaactagcgggacggtctactcatttttgtcctcaatgtcaaaaa
taa

DBGET integrated database retrieval system