KEGG   Trichodesmium erythraeum: Tery_1296Help
Entry
Tery_1296         CDS       T00387                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ter  Trichodesmium erythraeum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ter00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_1296
CYORF: 
UniProt: 
Position
complement(1977141..1978658)
Genome map
AA seq 505 aa AA seqDB search
MLLSRSSGILLHPTSFPSPFGIGDLGQEAYNFVNFLKNSGQKIWQVLPLGPTGFGNSPYQ
AYSAMAGNPLLISPDKLKDEGWLSEEDFSNIPEFPRDKVDFDSVAQVKSSLLKTAYQNFQ
KYASEEKKETFNQFSNSKAFWLDDYAFYMALKEAHEGASWHTWDQDIAHRQPQALAEWQQ
RLADKIQYHKFLQYLFFQQWDQLKSYANQQGIKIFGDVPIYVAHDSADVWSHPEIFSLDS
QTSEPSLMAGVPPDYFSETGQLWGNPVYQWDKLEQEDFFWWVQRIQSMLDIVDLIRIDHF
LGLVSYWAVPQGETTAKNGTWITAPGRAFFKTIKEKLGKLPVIAEDLGVITTEVEQLRDQ
FEFPGMKILHFAFDSGSDNLYLPCNYNSANWVVYTGTHDNNTTVGWFNKRSPQEQERVYR
FVGNSWGHGIHWDLIRLAMSSVAYMAIFPLQDILGLGEEAIMNQPGVPDGNWSWRYRSEM
LTSDISDRLKEVTDIYGRTPTNNED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctactttcgagatctagcggtattttactgcatccaacttcttttcccagtcccttt
ggaattggtgacttaggccaggaagcatacaattttgtgaattttttgaaaaatagtgga
caaaaaatttggcaagttctaccattagggccaacaggctttggcaattctccctatcaa
gcttattcagcaatggcaggaaatcctctgttaattagtccagataagttaaaagatgaa
ggatggctttctgaggaagatttttctaatataccagaatttccaagggataaggtagat
tttgattcagttgcccaagtaaaaagttctttgctgaaaactgcttaccaaaactttcaa
aaatatgcttctgaagaaaaaaaagagacattcaatcaattcagtaacagtaaagctttt
tggttagacgattatgctttttatatggctttgaaagaggctcacgaaggagcaagttgg
catacctgggatcaagacatcgctcatcgtcaaccacaagcattagcagaatggcaacaa
cgtttagctgataaaattcagtaccataaatttcttcaatatttattctttcagcaatgg
gatcagctgaaaagttatgctaatcaacaaggaattaaaatctttggcgatgttcctata
tatgttgcccatgatagtgctgatgtttggtcacatccagaaatattctctttagattca
caaacaagtgaaccatctttaatggctggcgttcccccagattattttagtgagactggt
caactatggggtaatccagtttatcagtgggataaattggaacaggaagattttttttgg
tgggtacaacggattcagtctatgctggatatagttgatttgattaggattgaccatttt
ctaggtttggtttcttattgggcagtaccccaaggtgaaactacagctaaaaatggtaca
tggattacagctccaggtagggctttttttaaaactattaaagaaaagttaggtaaactg
ccagttattgctgaggatttaggagttattactactgaagtagaacaattacgggatcag
tttgaatttcctggtatgaaaattctacattttgcttttgactcaggtagtgataatctc
tatttaccctgcaattataattctgctaattgggttgtttatactggcactcacgataac
aatactactgtcggctggtttaataagcgttctcctcaagaacaggaaagagtttatcgt
tttgttggtaatagttggggtcatggcattcattgggatttaattcgtttagctatgtct
tctgtggcttatatggcaatttttcctctacaagatattttagggttgggggaagaagct
attatgaatcagcctggtgttcctgatggtaattggagttggcgttatcgatcagagatg
ttaacttcagatataagtgatcgcctcaaagaggtgacagatatttatggtcgtacccca
acaaataacgaggattaa

DBGET integrated database retrieval system