KEGG   Trichodesmium erythraeum: Tery_1368Help
Entry
Tery_1368         CDS       T00387                                 

Definition
(GenBank) Methyltransferase type 12
Organism
ter  Trichodesmium erythraeum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_1368
CYORF: 
UniProt: 
Position
complement(2098603..2099235)
Genome map
AA seq 210 aa AA seqDB search
MVEEQSKDFLEARPWLSGICDTQSTEELKNKYDGWAKTYDTDVRKDWFFMPGNIAITLSQ
LLPHKETAILDAGAGTGLVGEALAQQGYTNITAVDLSEKMLAIAKEREVYKALHHCNLED
SQIFNNSVTFDAIIAAGVFAYAHAGVKVLNNLFGLLREDGIFLLTIREDYRREMQIALDK
LPWTLVSEENFTIYDEAKLMYLLGFKREGY
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagaacaatccaaagatttcttagaagcaagaccttggttatcagggatttgt
gatactcaaagcactgaggaattaaaaaataagtatgatggttgggctaagacttatgat
acagatgtcagaaaagattggttttttatgcctggtaatatagcaataacattaagccaa
ctgcttcctcacaaagaaaccgcaattctggatgctggtgctggaacgggtttagtgggt
gaagctttagcccaacaaggatatacaaatattactgctgttgatttgtcagaaaaaatg
ctggcgatcgctaaagagagagaagtttacaaggctctccatcactgtaatttagaagat
tcccaaatttttaacaattcagtaacttttgatgctattattgcagcaggagtttttgct
tatgcccatgctggtgttaaggtattaaacaatctattcggtcttttaagagaggacgga
atttttttgttgacgatacgggaagactatcgccgtgaaatgcagatagcattagataaa
ttaccgtggacattagtcagtgaagaaaattttacgatctatgacgaagccaagttgatg
tatcttcttggttttaaaagggagggatattaa

DBGET integrated database retrieval system