KEGG   Trichodesmium erythraeum: Tery_1368Help
Entry
Tery_1368         CDS       T00387                                 

Definition
(GenBank) Methyltransferase type 12
Organism
ter  Trichodesmium erythraeum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 MTS NodS PrmA DREV Methyltransf_16 CMAS Methyltransf_32 Ubie_methyltran RrnaAD Methyltransf_18 STAT2_C
Motif
Other DBs
NCBI-ProteinID: ABG50680
JGI: Tery1368
CyanoBase: Tery_1368
CYORF: Tery_1368
UniProt: Q115Z4
Position
complement(2098603..2099235)
Genome map
AA seq 210 aa AA seqDB search
MVEEQSKDFLEARPWLSGICDTQSTEELKNKYDGWAKTYDTDVRKDWFFMPGNIAITLSQ
LLPHKETAILDAGAGTGLVGEALAQQGYTNITAVDLSEKMLAIAKEREVYKALHHCNLED
SQIFNNSVTFDAIIAAGVFAYAHAGVKVLNNLFGLLREDGIFLLTIREDYRREMQIALDK
LPWTLVSEENFTIYDEAKLMYLLGFKREGY
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagaacaatccaaagatttcttagaagcaagaccttggttatcagggatttgt
gatactcaaagcactgaggaattaaaaaataagtatgatggttgggctaagacttatgat
acagatgtcagaaaagattggttttttatgcctggtaatatagcaataacattaagccaa
ctgcttcctcacaaagaaaccgcaattctggatgctggtgctggaacgggtttagtgggt
gaagctttagcccaacaaggatatacaaatattactgctgttgatttgtcagaaaaaatg
ctggcgatcgctaaagagagagaagtttacaaggctctccatcactgtaatttagaagat
tcccaaatttttaacaattcagtaacttttgatgctattattgcagcaggagtttttgct
tatgcccatgctggtgttaaggtattaaacaatctattcggtcttttaagagaggacgga
atttttttgttgacgatacgggaagactatcgccgtgaaatgcagatagcattagataaa
ttaccgtggacattagtcagtgaagaaaattttacgatctatgacgaagccaagttgatg
tatcttcttggttttaaaagggagggatattaa

DBGET integrated database retrieval system