KEGG   Trichodesmium erythraeum: Tery_1380Help
Entry
Tery_1380         CDS       T00387                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tery_1380 (tpiA)
   01230 Biosynthesis of amino acids
    Tery_1380 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_1380 (tpiA)
   00051 Fructose and mannose metabolism
    Tery_1380 (tpiA)
   00562 Inositol phosphate metabolism
    Tery_1380 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tery_1380 (tpiA)
Enzymes [BR:ter01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tery_1380 (tpiA)
Exosome [BR:ter04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tery_1380 (tpiA)
  Exosomal proteins of bladder cancer cells
   Tery_1380 (tpiA)
  Exosomal proteins of melanoma cells
   Tery_1380 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_1380
CYORF: 
UniProt: 
Position
2113589..2114314
Genome map
AA seq 241 aa AA seqDB search
MRKTIIAGNWKMYKTQLEAKEFLEGLMSQLTKTPEEREVVLCTPFTALDFMSKILHGSLI
RLGAQNVHWEDEGAYTGEISGLMLKDVGVSYVIVGHSERRQYFGETDETVNMRLKAAQKH
GLTPILCVGETKQQRDSGETESHIFSQLANDLVDVDQENLVIAYEPIWAIGTGDTCEAKE
ANRVIGLIRGKLNNSNVTIQYGGSVKPNNVDDIMAQEEIDGALVGGASLNPESFSRLVNY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaactataattgctggtaattggaaaatgtacaagacccaactagaagctaaa
gagtttctcgagggtttgatgtctcaactaacaaaaacccccgaagaacgtgaagtagtt
ctctgcactcccttcacggcactagattttatgtcaaaaattttgcatgggagtctgatc
aggttaggtgcgcaaaatgttcactgggaagatgaaggagcatatacaggagaaatttct
ggcttaatgctgaaagatgtgggagttagttatgtaattgtgggtcacagtgagcgccgt
caatattttggcgaaactgatgaaacggtgaatatgcgcttaaaagctgctcagaagcac
ggtttaacccctattctctgtgtgggagaaactaaacaacaaagagattcaggtgagaca
gaatcacatatattttctcagttggccaatgatttagttgatgtcgatcaagaaaatcta
gtaattgcttatgaaccaatatgggccattggtactggtgatacctgtgaagctaaagaa
gctaaccgagttattggtttaattcgtggtaagttaaataattctaatgtcactattcaa
tatggcggttctgttaaacctaataatgttgatgatattatggcacaagaagaaattgat
ggtgctttagttgggggtgcaagtttgaatcccgagagttttagtcgtttggttaactat
caataa

DBGET integrated database retrieval system