KEGG   Trichodesmium erythraeum: Tery_1381Help
Entry
Tery_1381         CDS       T00387                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ter  Trichodesmium erythraeum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ter00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_1381
CYORF: 
UniProt: 
Position
2115235..2116080
Genome map
AA seq 281 aa AA seqDB search
MQSLTESFIWGKRTYIMGILNVTPDSFSDGGDFNTPETALMQAKKMVKAGADMIDIGGQS
TRPGSEVVSIDEELNRVLAIIKLLRSNKNIGAEIIISVDTTRAIVAEKSVEAGANLINDI
SAGTYDDEMFSVVAALKVPIILMHIRGTPKTMQKLTDYQDLIGEIYQFLESRIKIAFKAG
IKREKIIIDPGIGFAKNYEQNLEIIRNLSRFKSLNCPILVGLSRKSFIGQILNQPNAKQR
VWGTAAGCVAAIAQYVDILRVHDVKEMSEVCRVADIIFRNK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtttaactgaaagttttatttggggaaaacgtacctacataatgggtattttg
aatgttacaccagatagttttagcgatggtggtgattttaatacaccagaaacagcttta
atgcaggcaaaaaaaatggtgaaggcgggtgctgatatgattgatattggtggtcaatca
actagaccagggtctgaagttgtttccatagatgaggaacttaatcgtgttttagcaata
attaagttgttaagaagcaataaaaatattggtgctgaaattataatttctgttgatact
actagggcgatagttgcagaaaaatctgttgaagctggtgctaatttaattaatgatatt
tctgctggaacatatgatgatgaaatgttttctgtggtagctgctctgaaagttccgatt
atcttaatgcacatccgtggtacaccaaaaactatgcaaaaattgacagactatcaagat
ttaattggggaaatttatcagtttttagagagcagaattaagattgcttttaaagcagga
attaaaagagagaaaattattattgaccctggtattggttttgctaaaaattacgaacaa
aatttagaaattatccgcaatttatcaagatttaaaagtttaaattgtcccattttagtg
ggattatctcgtaaaagttttattggtcaaattttaaatcaacctaatgctaaacaaagg
gtttggggaactgctgctggttgtgtggcagcgatcgctcaatacgtagatattttacgg
gttcacgatgttaaagaaatgtctgaagtttgtcgagttgctgatattatttttaggaat
aaataa

DBGET integrated database retrieval system