KEGG   Trichodesmium erythraeum: Tery_1416Help
Entry
Tery_1416         CDS       T00387                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ter  Trichodesmium erythraeum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ter00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tery_1416 (recR)
DNA repair and recombination proteins [BR:ter03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tery_1416 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_1416
CYORF: 
UniProt: 
Position
complement(2143846..2144394)
Genome map
AA seq 182 aa AA seqDB search
MPGVGPKTAQRLALYIIKRPEAEIQALAEALVDARKKIGLCQKCFHLSAEPICEICRNPQ
RDKEVICVVCDSRDLIALEKTREYKGQYHVLGGVISPMDGIGPEQLSIQPLVRRVSQENI
QEVIIAISPSVEGETTTLYVGQLLRPFTKVTRIAFGLPMGGDLEYADELTLARALEGRQE
LE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgcctggagttggcccgaaaacagcacaacgtttagcactatatattattaagcgcccg
gaagcagaaattcaagctttagctgaagctctggttgatgcgaggaaaaaaataggttta
tgtcagaagtgtttccatttatctgctgaacctatttgtgaaatttgtcgcaaccctcag
cgagacaaagaagttatttgtgttgtctgtgactcccgtgatttaattgccttggaaaaa
acacgggaatataagggtcaatatcacgttctgggtggagtaatttcgcctatggatggt
attggtccggaacagttgagtattcaaccattggtacggcgagtgagtcaggaaaatatt
caggaagtaattattgctattagtcccagtgtggaaggagaaactactactttatatgtg
ggtcagttgttgagaccttttacaaaagttacccgcattgcttttggtctgcctatggga
ggagatttagaatatgctgatgagttgacgttggcgcgtgccttagaagggcggcaggaa
ttagagtag

DBGET integrated database retrieval system