KEGG   Trichodesmium erythraeum: Tery_1416Help
Entry
Tery_1416         CDS       T00387                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
ter  Trichodesmium erythraeum
Pathway
ter03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ter00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tery_1416
DNA repair and recombination proteins [BR:ter03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Tery_1416
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tery_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH Adeno_E3_CR1 HHH_5 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ABG50712
JGI: Tery1416
CyanoBase: Tery_1416
CYORF: Tery_1416
UniProt: Q115W2
Position
complement(2143846..2144394)
Genome map
AA seq 182 aa AA seqDB search
MPGVGPKTAQRLALYIIKRPEAEIQALAEALVDARKKIGLCQKCFHLSAEPICEICRNPQ
RDKEVICVVCDSRDLIALEKTREYKGQYHVLGGVISPMDGIGPEQLSIQPLVRRVSQENI
QEVIIAISPSVEGETTTLYVGQLLRPFTKVTRIAFGLPMGGDLEYADELTLARALEGRQE
LE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgcctggagttggcccgaaaacagcacaacgtttagcactatatattattaagcgcccg
gaagcagaaattcaagctttagctgaagctctggttgatgcgaggaaaaaaataggttta
tgtcagaagtgtttccatttatctgctgaacctatttgtgaaatttgtcgcaaccctcag
cgagacaaagaagttatttgtgttgtctgtgactcccgtgatttaattgccttggaaaaa
acacgggaatataagggtcaatatcacgttctgggtggagtaatttcgcctatggatggt
attggtccggaacagttgagtattcaaccattggtacggcgagtgagtcaggaaaatatt
caggaagtaattattgctattagtcccagtgtggaaggagaaactactactttatatgtg
ggtcagttgttgagaccttttacaaaagttacccgcattgcttttggtctgcctatggga
ggagatttagaatatgctgatgagttgacgttggcgcgtgccttagaagggcggcaggaa
ttagagtag

DBGET integrated database retrieval system