KEGG   Trichodesmium erythraeum: Tery_1792Help
Entry
Tery_1792         CDS       T00387                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ter  Trichodesmium erythraeum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Tery_1792
Enzymes [BR:ter01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Tery_1792
Transfer RNA biogenesis [BR:ter03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Tery_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_1792
CYORF: 
UniProt: 
Position
2736273..2737244
Genome map
AA seq 323 aa AA seqDB search
MAYEREKQIAIESALAAAKLCEQVRINIPPAMEKGDKSPVTVADYGAQALICKALAEAFP
NDPVVGEEDATELQTPEMAENLTKVTNYVQEQITNATPEQVVQWINQGNGKVGPRYWTLD
PIDGTKGFLRQDQYAVALALVEEGEVKVGVLACPAMPVENNQPGMLYVAVRGEGAAMMPI
AGGELTPIQVVQADDTAHLRFVESVESSHGDQDRQNAVAKAVGITAASVRVDSQAKYGIV
ASGQAALYLRLPSPKSPNYRENIWDHAAGAIVVEEAGGRVSDIHGKPLNFADGAKMLENR
GIVVSNKIIHDQVLSILKQLSVK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaacgcgaaaaacaaatagcaatagaatctgccctagcagcagccaaactc
tgcgaacaggtgcgtatcaatattcccccagcaatggaaaagggcgacaaaagtcctgta
actgttgctgactatggtgctcaggcattaatttgtaaagctttagctgaagcttttccc
aatgatccagtggtaggagaagaagatgctactgagttacaaactccggaaatggcagaa
aatttgacaaaagtgacaaattatgtgcaagaacaaataacaaatgctactccagaacag
gtagtacagtggattaaccaaggtaatggtaaagttggaccccgttattggacgttagac
cctattgatggcacgaaagggtttttacgtcaagaccaatatgcagtagctttagcatta
gtcgaagaaggagaagttaaagtcggggtgttagcttgtcctgcaatgccagtagaaaat
aatcaaccaggaatgttatatgtagcagtaagaggtgaaggtgcagcaatgatgccaata
gcagggggcgaactgactcccattcaagttgtgcaggctgatgatactgctcatcttcgg
tttgttgagagcgtggaaagttctcacggcgaccaagaccgtcagaatgctgtagcaaaa
gcagtaggtattacagcagcatcagttagagtagactcccaagcgaaatacggtatcgtt
gcatctggacaagctgctttgtatttgcgcttgccctcaccaaagtctccaaattaccga
gaaaatatttgggatcatgctgctggtgcgatcgtagttgaggaagcaggagggcgtgtt
tctgatattcatggcaaaccattaaattttgctgatggcgcaaagatgcttgagaacagg
ggtatagttgttagtaataaaataattcatgaccaggttttatctattttaaaacagctt
tcagttaagtag

DBGET integrated database retrieval system