KEGG   Trichodesmium erythraeum: Tery_1831Help
Entry
Tery_1831         CDS       T00387                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ter01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ter00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ter00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ter00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_1831
CYORF: 
UniProt: 
Position
2795958..2797253
Genome map
AA seq 431 aa AA seqDB search
MIKEIFMPALSSTMTEGKIVSWQKTSGDWVEKGETVVVVESDKADMDVESFFSGYLATII
VEAGDVAPVGSTIGLLAETEAEIEQAKQQGVTTLNKEPANTSSSTTPVATAPISTATENQ
ENSSRRNGRIIASPRARKLAKDLKVDLSTLKGNGPHGRIVAEDVEMAAGRIPAVVAASAK
STIPTTPTQVSIPAPPPPPSVVSAPVTPGQVVPMNSLQNAVVRNMNVSLSVPTFHVGYTI
TTDNLDRLYKQIKSKGVTMTAILAKAVAITLQKHPLLNAVYVDQGIQYPSGINIAVAVAM
PDGGLITPVLPNADKMDIYSLSRTWKGLVDRARAKQLQANEYSTGTFTISNLGMFGVNRF
DAILPPAQGSILAIGASQPQVVATDDGMIGVKRQMEVNITCDHRIIYGADAAAFLQDLAN
LIENNSQSLTM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagaaatatttatgcctgcccttagttctaccatgaccgagggtaaaattgtt
tcttggcaaaaaacttccggtgattgggtagaaaagggcgaaacagttgtggtggttgaa
tcagacaaagcagatatggatgtggaatccttcttttctggatatttggccacaattatt
gtggaagcaggagatgtcgctccagttggatctactattggtttgttagctgaaacagag
gcagaaattgagcaggcaaagcaacaaggtgtgactactctaaacaaagaacctgctaat
acttctagctccacaactcctgtggccacagctcctatttctacagccacagaaaaccaa
gaaaattctagtcgtcgtaatggacgaattattgcttcccctcgtgcccggaagttggcc
aaagatttgaaggtcgatttgagtaccctcaaaggtaatggtcctcatggtcgtattgtg
gcagaggatgtggaaatggcggcgggtcgtatacctgctgtggtagctgcatcagcaaag
agtactattcctactactccaactcaagtatctattcctgctccaccaccaccaccatct
gtagtgtctgctccagtaactcctggtcaagttgtgccaatgaatagtctgcaaaatgca
gtggtgcggaatatgaatgtaagtttatctgtaccgactttccatgttggttatactata
actacagataatttggataggttgtacaaacaaattaagtctaagggtgtgactatgact
gctattttggcaaaagcagtggcaataaccttacaaaaacatcctttgttgaatgctgtt
tatgtggatcagggtattcagtatccctctgggattaatattgcagtggcagtagcaatg
ccagatggtggtttgattacaccagtattgccaaatgctgacaaaatggatatttattct
ttgtctcgtacttggaaaggtttggtagatagggcgcgggcaaaacaattacaagcaaat
gaatacagcactggtacctttactatttctaatttgggaatgtttggggtaaataggttt
gatgctattttaccacctgctcaaggttcgattttggcgatcggcgcatctcaaccccag
gtagtggccactgatgatgggatgattggggttaagcgacaaatggaggtgaatattact
tgtgaccatcggattatttatggtgctgatgctgctgctttcttgcaagatttggcgaat
ttgattgaaaataattcacagtctttgactatgtag

DBGET integrated database retrieval system