KEGG   Trichodesmium erythraeum: Tery_1864Help
Entry
Tery_1864         CDS       T00387                                 

Gene name
ribC, ribF
Definition
bifunctional riboflavin kinase/FMN adenylyltransferase (EC:2.7.1.26 2.7.7.2)
Orthology
K11753  
riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
ter  Trichodesmium erythraeum
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Tery_1864 (ribC)
Enzymes [BR:ter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     Tery_1864 (ribC)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     Tery_1864 (ribC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_1864
CYORF: 
UniProt: 
Position
complement(2850070..2851176)
Genome map
AA seq 368 aa AA seqDB search
MWITSSLATALTPTAVALGNFDGLHQGHRQVIEPILNLKGRSKLLSVCPSELTRTTEVDE
DTKLKLWHQDSKLSSWHFENELGKNDDYLRQKIYSTVVTFNPHPQEFFSGKPKKLLAPLE
EKLAIFKHIGVEQVVLLPFDRNLADLTPNKFVEEILVKGLQVHQISVGCDFCFGQKRAGK
AKDLQAIAGYYDIDVTTVPLYHSENGERISSSIIRQALEKGDLDKSNRLLGRPYSLIGEV
VHGQQLGRTLGFPTANLQLAAQKFLPRFGVYAVEVYLSRQKQPQEILHAESPYLGVMNVG
CRPTLNSLDPTVEVHLLDMSQDLYGQTLTVNLIEFLRPEQKFASLDLLKAQIYEDCRIAR
SILKNQTI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgtggataacttcttctttagctacagctctaactccaacagcagttgccttaggaaac
tttgatggtttacatcaaggacataggcaagtaatagaaccaattttaaacttaaagggt
agatcaaagttactttctgtttgtccatcagaattgacaagaactacagaagtagatgaa
gatacaaagcttaaattatggcatcaagattcaaaattatcatcatggcattttgaaaat
gaattgggaaaaaatgatgattacctaaggcaaaaaatttattccactgttgttactttt
aatcctcatccacaagagttttttagtggaaaaccaaaaaaattgttagctccactagaa
gaaaaattggcaatatttaaacatatcggagttgaacaagtagtattattgccatttgat
cgaaatttggccgatctaactcctaataaatttgtagaagaaattttagtaaaaggctta
caagtacatcaaataagcgtggggtgtgatttttgttttggacaaaaaagagcaggaaag
gccaaagatttgcaggcgatcgctggttactatgatatagatgtaacaactgtacctcta
tatcatagtgaaaatggagagcgtattagtagttctataattcgtcaagctttagaaaaa
ggagatctagataaatcaaatcgtttattaggtcgtccttacagtttaattggtgaagtg
gtgcatggacaacaactaggtagaactttaggatttcctacagcaaatcttcagctagca
gcacaaaaattcttgcctcgttttggggtttatgctgtggaagtctatctttctcgacaa
aaacaacctcaagaaatacttcatgctgagagcccctatttaggagtaatgaacgttggt
tgccgccctacattaaatagtttagatccaactgttgaagttcacctattagatatgtct
caagatttatatggtcaaactttaactgtaaatttgatagagtttttgcgacctgaacaa
aaattcgcttctctagatttactgaaagctcaaatatatgaagattgtagaattgctaga
agtatacttaaaaatcaaactatataa

DBGET integrated database retrieval system