KEGG   Trichodesmium erythraeum: Tery_1864Help
Entry
Tery_1864         CDS       T00387                                 

Gene name
ribC, ribF
Definition
bifunctional riboflavin kinase/FMN adenylyltransferase (EC:2.7.1.26 2.7.7.2)
Orthology
K11753  
riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
ter  Trichodesmium erythraeum
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:ter00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_1864
CYORF: 
UniProt: 
Position
complement(2850070..2851176)
Genome map
AA seq 368 aa AA seqDB search
MWITSSLATALTPTAVALGNFDGLHQGHRQVIEPILNLKGRSKLLSVCPSELTRTTEVDE
DTKLKLWHQDSKLSSWHFENELGKNDDYLRQKIYSTVVTFNPHPQEFFSGKPKKLLAPLE
EKLAIFKHIGVEQVVLLPFDRNLADLTPNKFVEEILVKGLQVHQISVGCDFCFGQKRAGK
AKDLQAIAGYYDIDVTTVPLYHSENGERISSSIIRQALEKGDLDKSNRLLGRPYSLIGEV
VHGQQLGRTLGFPTANLQLAAQKFLPRFGVYAVEVYLSRQKQPQEILHAESPYLGVMNVG
CRPTLNSLDPTVEVHLLDMSQDLYGQTLTVNLIEFLRPEQKFASLDLLKAQIYEDCRIAR
SILKNQTI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgtggataacttcttctttagctacagctctaactccaacagcagttgccttaggaaac
tttgatggtttacatcaaggacataggcaagtaatagaaccaattttaaacttaaagggt
agatcaaagttactttctgtttgtccatcagaattgacaagaactacagaagtagatgaa
gatacaaagcttaaattatggcatcaagattcaaaattatcatcatggcattttgaaaat
gaattgggaaaaaatgatgattacctaaggcaaaaaatttattccactgttgttactttt
aatcctcatccacaagagttttttagtggaaaaccaaaaaaattgttagctccactagaa
gaaaaattggcaatatttaaacatatcggagttgaacaagtagtattattgccatttgat
cgaaatttggccgatctaactcctaataaatttgtagaagaaattttagtaaaaggctta
caagtacatcaaataagcgtggggtgtgatttttgttttggacaaaaaagagcaggaaag
gccaaagatttgcaggcgatcgctggttactatgatatagatgtaacaactgtacctcta
tatcatagtgaaaatggagagcgtattagtagttctataattcgtcaagctttagaaaaa
ggagatctagataaatcaaatcgtttattaggtcgtccttacagtttaattggtgaagtg
gtgcatggacaacaactaggtagaactttaggatttcctacagcaaatcttcagctagca
gcacaaaaattcttgcctcgttttggggtttatgctgtggaagtctatctttctcgacaa
aaacaacctcaagaaatacttcatgctgagagcccctatttaggagtaatgaacgttggt
tgccgccctacattaaatagtttagatccaactgttgaagttcacctattagatatgtct
caagatttatatggtcaaactttaactgtaaatttgatagagtttttgcgacctgaacaa
aaattcgcttctctagatttactgaaagctcaaatatatgaagattgtagaattgctaga
agtatacttaaaaatcaaactatataa

DBGET integrated database retrieval system