KEGG   Trichodesmium erythraeum: Tery_2112Help
Entry
Tery_2112         CDS       T00387                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ter  Trichodesmium erythraeum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ter00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ter00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ter00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ter00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_2112
CYORF: 
UniProt: 
Position
complement(3298305..3299189)
Genome map
AA seq 294 aa AA seqDB search
MTETTAKVRKAVIPAAGFGTRMFPVTKVVKKELFPIIDKDGRAKPIIQIIIEEAISGGIE
EVGVVVQESDRQIFTDYFQGVPSYYEKLSPEKQEYCQYLQNLGNKITFLTQEQQAGYGHA
VFCAKDWVRDEPFLLLLGDHLYTSEVTKSCTSQFLQVYEQTNKSVLGVRIIPGTEIHHYG
CIGGTLVADSLINIDTIYEKPDLNYAREKLHVLGMKKEHFLGVFGIYVLTARIFDYLEEN
IKQNAREKGEFQLTSCLDKLQKAEGMTGYLVKGRCFDTGMPDVYWQTMIDFRNA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacaacagctaaagtaagaaaagcagtaattccagcggcaggtttcggtaca
aggatgttcccagttactaaagttgtgaaaaaagaactatttcccataatagacaaagat
ggcagagctaaaccaataattcaaataattattgaagaggctataagtggtggaatagaa
gaggtgggagtggtggtacaggaaagcgatcgccaaatttttacagactatttccaaggt
gttcctagttattatgaaaaactctccccggaaaaacaagaatattgccaatatttacaa
aatttaggtaataaaattactttcttaactcaagagcagcaggctggttatggtcatgct
gttttctgtgctaaagattgggtaagagacgaaccttttttgctattactgggggatcat
ctttatacttctgaggtcacaaaatcctgtacaagtcaatttttgcaagtctatgaacag
acgaataaaagtgtacttggggtgagaattatcccaggaacagaaatacatcattatggt
tgtattggtggaactttagttgccgatagtctaattaatattgatacaatttatgaaaaa
ccagacctaaattatgccagagaaaagcttcatgtgttagggatgaaaaaagaacacttt
ttaggagtttttgggatatatgtattaaccgcaagaatatttgattacctagaagaaaac
attaaacaaaatgcgagggaaaaaggagaatttcaactgacatcttgtttagataaatta
caaaaagcagaaggaatgacagggtatttagtcaaagggcgatgttttgatacggggatg
ccagatgtgtattggcagacaatgattgattttcgtaatgcttga

DBGET integrated database retrieval system