KEGG   Trichodesmium erythraeum: Tery_2750Help
Entry
Tery_2750         CDS       T00387                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ter  Trichodesmium erythraeum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tery_2750
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tery_2750
   00640 Propanoate metabolism
    Tery_2750
   00660 C5-Branched dibasic acid metabolism
    Tery_2750
Enzymes [BR:ter01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tery_2750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_2750
CYORF: 
UniProt: 
Position
4259401..4260618
Genome map
AA seq 405 aa AA seqDB search
MDLLEYQAKALFSEMGIPVLPSQRIDYPKDLKKLKIPYPVVLKSQVHTGERSSLGGIKFV
ENTIDAVAAAQTIFNLPIKDEYPAVLLAEAKYNADQELYLAVVLDPIVRRPVLLGSKQGG
IDTETAIKSMQKVVVNQEFSPFYARRLMVKIGLEGKLIELVSHIVEKMYQLFVEKDLDMI
EINPLGISPKGEVMALDGKVSVNDYALGRHPELLSIVGQNISDNYEIKQKEVKEIEDSSL
LVFNNINAVSNRKIIPDYRLKFKELQGNIGILCNGKGLTMATVDMVIQAQGKPANFLNIK
LGDYLEVKNSLRSQMFTALDLVSQRDNIKVVLINVIGIVETSDELITIVYEYLNKLTSID
QKKIRFVLRLLGGRISKARERLSDLPVEVIENLEDAVSQAVYLSK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggatttattagaatatcaggcaaaagcattgtttagtgagatgggaatacctgttttg
ccatctcaaagaatagattatcctaaagatttaaaaaaattaaaaatcccttacccagtt
gtactaaagtctcaagttcatactggggaaagaagtagcttagggggtattaaatttgtc
gaaaatacaattgatgctgtagcagcagctcagacaatttttaatttgccaattaaagat
gagtatccagcagttttgttggcagaggcaaagtacaatgctgaccaggaattatatttg
gcagttgttttagacccaatagtacgtcgccctgtacttcttggttcaaaacaagggggt
attgatacagaaacagcgattaaaagtatgcaaaaggtggttgttaatcaagaattttct
cctttttatgcacgtcgtttaatggtgaaaattggactggaaggaaaactaatagaatta
gtcagtcatatagtggaaaaaatgtatcaattatttgttgaaaaggatttagatatgata
gaaattaatccgctgggtattagcccaaaaggagaagtaatggctttagatggtaaggtt
agtgttaatgattacgctctaggtcgtcatccagaattattaagtatagtagggcaaaat
attagtgataattatgaaattaaacagaaagaagttaaggaaatagaggatagttcttta
ttagtgttcaacaatattaatgctgtcagtaatagaaaaataattccagactatcgactg
aaatttaaagaattacagggaaatattggaattttatgcaatggtaagggtttaacaatg
gctactgtagatatggttatacaagctcagggaaaaccagctaattttctaaatattaag
ctaggtgattatttggaagttaagaatagtttacgatcgcaaatgtttacagctttggat
ttagttagtcaaagagacaatattaaggtggttttaataaacgttataggtatagttgaa
acaagtgatgagttaattactatagtatatgaatatttgaataaattaacaagtatagac
cagaaaaaaattcggtttgtgctgcgtttattaggaggtagaattagcaaagctagggaa
cgtttatcagatctacctgtagaggttatagaaaacttagaggatgcagtgagccaggct
gtttatttgtctaaatag

DBGET integrated database retrieval system