KEGG   Trichodesmium erythraeum: Tery_2811Help
Entry
Tery_2811         CDS       T00387                                 

Definition
(GenBank) Tetratricopeptide TPR_2
Organism
ter  Trichodesmium erythraeum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_1 TPR_7 TPR_10 TPR_2 TPR_8 TPR_14 TPR_16 TPR_11 TPR_6 TPR_3 TPR_19 SNAP ANAPC3 Rapsyn_N ANAPC5 MIT DUF2989 TPR_21 LUC7
Motif
Other DBs
NCBI-ProteinID: ABG51987
JGI: Tery2811
CyanoBase: Tery_2811
CYORF: Tery_2811
UniProt: Q110T7
Position
4363322..4365670
Genome map
AA seq 782 aa AA seqDB search
MRKMVDTENNTQGGVILPSAESVLKLLNLDPDGLMSIKPLSKRLQYQAVIIWLSDYKCPQ
RVNDNLEVVKGYLEAFYHLCEVGDWERAKQIYFIKVPPVNEELRTQLMRWGCYKECIQLY
SRLLGKLDQYWDGICLTDLGNVYYSQGEYDKAMEYYQQRLQIAREIGDRSGEGGALGNLS
NVYYSQGEYDKAMEYYQQSLQIARKIGNRSWEVAALIGLGDFYDSQGEYDKAMEYYQQSL
QIAREIGNRSGEGIALGNLGNVYYSQGEYDKAMEYHQQDLQIAREIGNRSGEGIALVNLG
VVYNSQGEYDKAMEYYQQSLQIAREIGDRSGEGGALGNLGNVYNSQGEYDKAMEYYQQSL
QIAREIGDRSGDGNALMGLGNVYYSQGEYDKAMEYYQQHLQIAREIGDRSGEGRTLGNLG
LVYYSQGEYDKAMESYQQDLQIAREIGDRSGEGISLGNLGDVYYSQGEYDKAMEYYQQHL
QIAREIGDRSGEGNALMGLGNVYHSQGEYDKAMEYYQQSLQIAREIGNRSGEGNALGNLG
NVYNSQGKYDKAMEYYQQHLQIARGIGDRSGEGRALGNLGVVYNSQGEYDKAMEYYQQSL
QIARQIGNRYGESNTLGNLGNVYNSQGEYDKAMEYHQQSLQIARQIGNRSEEGIVLGNLG
KVYNSQGEYDKAMEYHQQSLQIAREIGNRYWEGIALGNWGETLLKLEKYAASLEYSQAAL
EIFKQIGNPHHQGIALKNIAETHQHLGNLDAARQYCDEALAIFTELGAPELKECQEFRDK
LG
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagatggttgatactgaaaataatacccaaggtggagttattctaccttctgct
gagtctgttttgaaattgttgaacctggaccctgatggccttatgtccattaagccactt
tccaaacgtcttcaatatcaggctgttattatctggttgagtgactacaaatgtccgcaa
agagtaaatgataatttagaggtggtaaaaggctatctggaagcattttatcatctttgt
gaagtgggagactgggaacgagcaaagcaaatttattttattaaagtaccgccagttaat
gaagagttacgtactcaactaatgaggtggggttgttataaggaatgtattcaactctac
agtagactattaggtaaattagaccaatattgggatggtatttgtttaactgatttaggt
aatgtttactattcccaaggagaatatgacaaagctatggagtattatcagcagcgttta
caaatagctagggaaattggcgatcgttctggggagggtggtgctttggggaatttgagt
aatgtttactattcccaaggagaatatgacaaagctatggagtattatcagcagtcttta
caaatagctaggaaaattggcaaccgttcttgggaggttgctgctttgataggtttgggt
gatttttacgattcccaaggagaatatgacaaagctatggagtattatcagcagtcttta
caaatagctagggaaataggcaaccgctctggggagggtattgctttgggaaatttgggt
aatgtttactattcccaaggagaatatgacaaagctatggagtatcatcagcaggattta
caaatagctagggaaattggcaaccgttctggggagggtattgctttggtgaatttgggt
gtagtttacaattcccaaggagaatatgacaaagctatggagtattatcagcagtcttta
caaatagctagggaaattggcgatcgctctggggagggtggtgctttgggaaatttgggt
aatgtttacaattcccaaggagaatatgacaaagctatggagtattatcagcagtcttta
caaatagctagggaaattggcgatcgctctggggatggtaatgctttgatgggtttgggt
aatgtttactattcccaaggagaatatgacaaagctatggagtattatcagcagcattta
caaatagctagggaaataggcgatcgctctggggagggtcgtactttggggaatttgggt
cttgtttactattcccaaggagaatatgacaaagctatggagtcttatcagcaggattta
caaatagctagggaaataggcgatcgctctggggagggtatttctttggggaatttgggt
gatgtttactattcccaaggagaatatgacaaagctatggagtattatcagcagcattta
caaatagctagggaaattggcgatcgctctggggagggtaatgctttgatgggtttgggt
aatgtttaccattcccaaggagaatatgacaaagctatggagtattatcagcagtcttta
caaatagctagggaaattggcaaccgttctggggagggtaatgctttggggaatttgggt
aatgtttacaattcccaaggaaaatatgacaaagctatggagtattatcagcagcattta
caaatagcaaggggaattggcgatcgttctggggagggtcgtgctttgggaaatttgggt
gtagtttacaattcccaaggagaatatgacaaagctatggagtattatcagcagtcttta
caaatagctaggcaaataggcaaccgttatggggagagtaatactttggggaatttgggt
aatgtttacaattcccaaggagaatatgacaaagctatggagtatcatcagcagtcttta
caaatagctaggcaaataggcaaccgttctgaggagggtattgttttagggaatttgggt
aaagtttacaattcccaaggagaatatgacaaagctatggagtatcatcagcagtcttta
caaatagctagggaaataggcaaccgttattgggagggtattgctctaggaaattgggga
gaaactctgctcaagttagaaaaatatgccgcatctctggaatattcacaagctgcatta
gagatatttaagcagataggaaaccctcatcaccaaggaatagctcttaagaatatagca
gaaactcatcaacatttaggaaatttagatgcagcacgacagtattgcgatgaggcatta
gctattttcacagaattaggagcgccagaattgaaagaatgtcaagaattccgcgataaa
ttggggtag

DBGET integrated database retrieval system