KEGG   Trichodesmium erythraeum: Tery_2875Help
Entry
Tery_2875         CDS       T00387                                 

Definition
ROK domain-containing protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tery_2875
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_2875
   00052 Galactose metabolism
    Tery_2875
   00500 Starch and sucrose metabolism
    Tery_2875
   00520 Amino sugar and nucleotide sugar metabolism
    Tery_2875
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tery_2875
   00524 Butirosin and neomycin biosynthesis
    Tery_2875
Enzymes [BR:ter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tery_2875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_2875
CYORF: 
UniProt: 
Position
complement(4478487..4479398)
Genome map
AA seq 303 aa AA seqDB search
MNSLVIGIDIGGTSIKLGCFGRDGVCHQSLTVPTPRPATPKAVIDLIKEVISMMIKEPQI
YNLGPIQGIGIGVPGPVDAEGKTSIIAINLTDWQDVPLAKLLEEKTGLPVVIANDANCAG
LGEAWLGAGSQYKNLIMLTLGTGVGGAIILNSQLFVGHQGAAGELGLITLNLDGPKCNSG
NNGSLEQYISVQAVRRETGKEPLELANLALAGDKFALEFWQNYGRLLGAGLASLIYILTP
EAVIIGGGISAAAKLFLPATKAEVKRRVLLTSSLKLQLLIAKLGNQAGVIGAAKLAWTKF
SDQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaactctctagttataggcattgatataggaggaacatctatcaagttgggatgtttc
ggtagggatggagtatgtcatcaatctttaactgttccaactcctcgacctgctactcca
aaagcagttattgatctaataaaagaggtaatatctatgatgataaaagaacctcaaata
tacaacttaggacctattcaaggaataggtattggagtaccaggtcctgttgatgctgaa
ggtaaaacttctatcatagcaattaatttaacagattggcaagatgttcctctcgctaaa
ttgttagaggaaaaaactggtttaccagtagttatagctaatgatgctaactgtgctggt
ttaggagaagcttggttaggggcaggtagtcagtataaaaatctgattatgcttaccctg
ggtactggtgtcggaggagcaattatattaaatagccaattatttgtgggtcatcaaggt
gccgctggagagttaggcttaataactttaaacctcgatggacctaaatgcaatagtggc
aataatggttctttggaacaatatatttctgttcaagcagttcgtcgagagacaggaaaa
gaacctttagaattagccaatttagctttggctggagataaatttgctctagaattttgg
caaaattacggacgacttttaggagctgggttagcaagtttaatttatattttaactcca
gaagcagtgattattggtggtggaataagtgctgcagcaaaactttttttacctgcgact
aaggcagaagttaagcgacgagttcttctgacttcttctttaaagttacaattattaatt
gctaaattaggtaatcaagctggtgttattggagctgctaagttagcttggactaagttt
tcagatcaatga

DBGET integrated database retrieval system