KEGG   Trichodesmium erythraeum: Tery_3169Help
Entry
Tery_3169         CDS       T00387                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
ter01130  Biosynthesis of antibiotics
ter01230  Biosynthesis of amino acids
Module
ter_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tery_3169
Enzymes [BR:ter01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tery_3169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth ThiG IMPDH
Motif
Other DBs
NCBI-ProteinID: ABG52297
JGI: Tery3169
CyanoBase: Tery_3169
CYORF: Tery_3169
UniProt: Q10ZM7
Position
complement(4837154..4838047)
Genome map
AA seq 297 aa AA seqDB search
MQIRRRPPNPAVEMGTLRYEVSVPESKPKNILEEIVWHKEKEVDYLRDKEPLVELRKKIN
LMPPPLDFLTTLSTGKTQLAVIAEVKKASPSKGVIRQDFEPVAIAKLYQENAATCISVLT
DRKFFQGSFENLANIRENVDLPLLCKDFLIYPYQIYFARLYGADAVLLIAAILSDQDLKY
FIKIVNSLGMTALVEVHTLKELDRVLGIEGVKLIGINNRNLEDFSVDLQTTFQLMEARKK
ELEKLGILVVSESGIHSYEDINFMINAGVNAVLVGESLVKKTNPGTALLQLFNENKS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgtcgccgtccgccaaacccagcggtagaaatgggcactttacgctatgag
gtttccgtgccagagtcaaagcctaaaaatattctagaggaaatagtttggcataaggaa
aaagaggtagattatttgcgtgacaaagaacctttagttgagttaagaaaaaagattaac
ttaatgcctcctcctctggattttttgactacattatcaacaggaaaaactcaacttgct
gtaatagctgaagtgaaaaaagcttctcctagtaaaggagtaattagacaagattttgaa
ccagttgctattgctaagttatatcaggaaaatgctgcaacttgtatctcagttttaaca
gatagaaagttctttcaaggtagttttgaaaatttggcaaatattagggaaaatgttgat
ttaccattactttgtaaagacttcctaatttatccatatcaaatatactttgctcgctta
tatggagctgatgctgtgctattaatagcagcaattttatcagaccaagacttaaaatat
tttatcaaaatagttaattctttaggaatgacagcattagttgaagttcatactttgaaa
gaattagatcgggtattaggaatagaaggggttaagttaattggtataaataatcgcaac
ttagaagatttttcagtggatttacaaacaacttttcaactgatggaagctagaaagaaa
gaattagaaaaactcggaattttagttgtaagtgaatctggaatacatagttatgaagat
atcaattttatgataaacgctggtgtaaatgctgttttagtaggagagtctttagtcaaa
aaaacaaatccaggtacagcattgctacaactatttaatgaaaataaaagttaa

DBGET integrated database retrieval system