KEGG   Trichodesmium erythraeum: Tery_3224Help
Entry
Tery_3224         CDS       T00387                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
ter  Trichodesmium erythraeum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ter00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_3224
CYORF: 
UniProt: 
Position
complement(4932298..4936287)
Genome map
AA seq 1329 aa AA seqDB search
MFTSVKPTVRHIVPADLKGRSLLKVVYIVLEAQYQSSLSAAVRSINEKNPNLAIEISGYL
IEELRDPKNYENFRREVSEANIFIASLIFIEDLAEKVVEAVTPHRDKLDAAVVFPSMPQV
MRLNKMGTFSMAQLGQSKSAIAQFMRKRKEKSGSSFQDGMLKLLQTLPKVLKYMPLDKAQ
DARNFMLSFQYWLGGSSENLENFLLMLADKYVFKDQKKSSLQYVDPVVYPDMGIWHPLAP
KMFEDVKEYLNWYNNRKDISENLKDPLAPCVGLVLQRTHLVTGDDAHYVAMLQELEAMGA
RVLPVFAGGLDFSKPVDAYFWEVVTKGVEPTPLVDTVISLTGFALVGGPARQDHPKAVES
LKRLNRPYMVALPLVFQTTEEWQESDLGLHPIQVALQIAIPELDGAIEPIIMSGRDGATG
KAIALQDRIEAVAQRALKWASLRRKPKLNKKIAITIFSFPPDKGNVGSAAYLDVFGSIYE
VVKALKGNGYDIQDLPDSAEELMKQVIQDATAQYQSPELNIAYRMSVLEYERLTPYSERL
HENWGLPPGNLNSDGENLLIYGKSFGNVFIGVQPTFGYEGDPMRLLFSHSASPHHGFAAY
YTYLEQIWKADAVLHFGTHGSLEFMPGKQIGMSGHCYPDNLIGNIPNIYYYAANNPSEAT
IAKRRSYAETISYLTPPAENAGLYKGLQELNELIASYQTLKDSGRGVPIVNTIMDKCRIV
NLDQDVTLPEKDAQELTAEERDQVVGDVYRRLMEIESRLLPCGLHVIGKPPTAEEAIATL
VNIASLDREEEGITGLPRIIANSLNRDIEELYQNNNKGILADVELLQNITEGTRAAVAAL
VHQQTDAEGRVSMVGKLNFFNMRKKAPWIEALEAAGFPDVDEEAIKPLFEYLEFCLEQVC
ADNELGSLLRAFEGEYILPGPGGDPIRNPDVLPTGKNMHALDPQSIPTAAAVKSAKTVVD
RLLARQMQENGGQYPETIAVVLWGTDNIKTYGESLAQVMWMVGVKPVPDALGRVNKLELI
PLEELGRPRVDVVINCSGVFRDLFINQMNLLDKAVKMAAEAHEPEEMNFVRKHALKQAED
LGVNLRQAATRVFSNASGSYAANVNLAVENSTWEDESELQEMYLKRKSFAFNSDNPGMME
DNRKVFESALKTADATFQNLDSSEISLTDVSHYFDSDPTKVVATLRGDGKQPASYIADTT
TANAQVRSLSETVRLDARTKMLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATAGAVDN
WVYEDVNETFIQDKQMQQRLLNLNPHSFRKIVATLLEVNGRGYWETGESNLDRLRELYQQ
VEDRIEGIE
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgttcacatccgtaaagcctactgttcgccacattgtcccagcagacttaaaagggcga
tcgctcttaaaagtcgtatatatagttttagaagctcaatatcaaagctccctctcagca
gcagtgcgttctataaatgaaaaaaatcctaatctggccatagaaataagtggctatcta
attgaagaactccgggacccaaaaaactatgaaaactttaggcgagaagtttccgaagct
aacatctttatagcttccctaattttcattgaagacctagcagaaaaagtcgtagaagcc
gtcacaccccatcgcgacaaacttgacgctgctgtggttttcccttccatgccacaagtg
atgcgcctgaataaaatgggaacattctcaatggcccaactaggccagagcaaaagcgcc
attgctcaatttatgcggaagcggaaagaaaaatctggttcttcttttcaagacggaatg
ttgaaattactacaaactctgccaaaagttttgaagtatatgcctcttgacaaagcccaa
gatgctagaaactttatgctgagtttccagtattggttaggaggttcctcggaaaacctg
gaaaatttcctgctcatgttggcagacaaatacgttttcaaagaccagaaaaaaagttct
ctacaatatgtcgatcctgttgtttatccagacatgggtatctggcatcccctggcgccc
aaaatgtttgaggatgtcaaagaatatctcaactggtacaacaaccgtaaagacatttcc
gaaaatttgaaagatcccctggccccctgtgttggtcttgtcttgcagcgaacccaccta
gtgacaggagatgatgctcattatgttgccatgttgcaagagttggaagcaatgggagcg
cgagttctgcctgtatttgccggaggattagatttttctaaaccggtcgatgcctacttt
tgggaagtggtaactaaaggagttgaacctacaccattagtagatacggttatttcttta
actggttttgcattggtaggtggacctgctagacaagaccatccaaaagcggtagaatct
ttaaaaaggttgaaccgaccctacatggtagcattacctctggttttccaaactactgaa
gaatggcaagaaagtgaccttggtctccaccccatacaagttgctttgcaaatagctatt
cctgaacttgatggggcgatcgaacctatcattatgtctgggcgagacggagcaacggga
aaagcgatcgctctccaagaccgtatcgaagctgtagctcaacgcgctcttaaatgggca
agtcttagacgtaaacccaaactgaataaaaaaattgctattactattttcagtttccct
ccagataaagggaatgtgggtagtgctgcatatttagatgtatttggctctatctatgaa
gttgtgaaagcactcaaaggcaatggttacgatattcaagacttgccagactctgcagaa
gaattaatgaagcaagtcatccaagatgctactgcccaatatcaaagtccggagctcaat
attgcttaccgaatgtcagttctagaatatgaacgtctgacaccatactcggaaaggttg
catgaaaattggggactacctccaggaaacctgaatagcgatggcgaaaatttacttatt
tacggtaagagtttcggaaatgttttcatcggcgtccaaccaacatttggttatgaaggg
gaccccatgcggttgttattctcccattctgcaagtccccatcatggttttgctgcttac
tatacctatttagaacaaatttggaaagcagatgcagtcctacatttcggtactcacggt
tctttagaatttatgcctggcaagcaaattggtatgtctggacattgttacccggataat
ctcataggcaatattcccaacatctattattatgctgcaaataatcctagtgaggcaact
attgctaaacgccggagttatgctgagactatttcttacttaactccccctgcagaaaat
gctggtttatataaaggtttgcaggagttgaatgagttaatagcttcctatcaaactttg
aaggatagcgggcgaggtgttcctattgttaacactattatggataaatgccggatagtg
aatttagaccaggatgtaactctgccggaaaaagatgctcaggagttgaccgctgaggaa
cgggatcaagttgttggggatgtttatcgcaggttgatggaaattgagtcccggttgttg
ccttgtggtttgcacgttattggtaaacctcctactgctgaggaagcgatcgctactttg
gtaaatattgctagtttagaccgggaagaggaagggataactggtttacctcgaataatt
gctaatagcctcaaccgggatattgaggaactttaccaaaataataataaaggtattttg
gcagatgtggagttacttcagaatattacggaagggactcgtgctgctgtagcggcatta
gtgcaccaacaaactgatgctgagggtcgagtttcgatggtgggtaaactcaatttcttt
aatatgaggaaaaaagcaccttggatagaagctctggaagcagcaggttttcctgatgtt
gatgaagaagctatcaagcctctgtttgaatatttagagttttgcctagaacaggtttgt
gctgataatgagttgggttctctgttacgagcgtttgaaggggaatatattttaccagga
cccggtggcgaccccattcggaaccctgatgttttgcctactggtaagaatatgcacgct
ctcgacccccagtctattcctactgctgctgcggttaagtcggcaaaaactgtagttgat
cgtttattggcacgacagatgcaggagaatggtgggcagtatccagaaactatcgctgtt
gttttgtggggaactgataatatcaagacttatggtgaatctcttgctcaggtgatgtgg
atggtaggggttaaacctgtacctgatgctttgggtagggtgaataagctggagttaatt
ccccttgaagagttgggtcggccccgggttgacgtggtgattaattgttctggtgtattc
cgagatttatttattaatcaaatgaatcttttggataaggctgtgaaaatggcagcagaa
gcacatgaaccggaagagatgaattttgttcgcaagcatgctctcaagcaagctgaagat
ttgggagtgaatttacgtcaagctgcaacacgggtattttctaatgcttccggttcttat
gctgcaaatgtaaatttggcggtggagaatagtacttgggaagatgagtcggaattacag
gaaatgtatttgaagcgcaagtcttttgcttttaattctgataacccaggaatgatggag
gataaccggaaagtttttgagtcggcattgaaaactgctgatgcgacttttcagaattta
gattcgtctgagataagtttgaccgatgtgagtcattattttgattcggatccgacaaaa
gttgtggcaactctcaggggtgatggtaaacaaccagcttcttatattgcggatacgacg
actgcgaatgctcaggtacggtctttgtctgagacggtgcgtttggatgcgcgaacaaaa
atgttgaatccaaaatggtatgaggggatgttgtctcatggttatgaaggtgtgcgggag
ttgtctaagcgtctggtgaatactatgggatggagtgcgactgcaggcgcggttgataat
tgggtttatgaggatgtcaatgagacgtttattcaggataagcagatgcagcagcggttg
ttgaatttgaatccccattcgttccggaagatcgtagctacattgttggaggtgaatggt
cgcggttattgggagacaggtgagagtaatttggatcggttgcgggagttgtatcagcaa
gtggaggatcggatagaaggaatagaataa

DBGET integrated database retrieval system