KEGG   Trichodesmium erythraeum: Tery_3280Help
Entry
Tery_3280         CDS       T00387                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ter  Trichodesmium erythraeum
Brite
Enzymes [BR:ter01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Tery_3280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_3280
CYORF: 
UniProt: 
Position
5034589..5035557
Genome map
AA seq 322 aa AA seqDB search
MKAFVTGASGFIGANLVRLLLQQGYAVRSLVRPTSRLDNLQGLDIEVVVGDLNDSYLFEL
IEGCQVLFHVAAHYSLWQKDKELLYKNNVLGTRNVLAAARRAKIERTVYTSSVAAIGVGV
SSTVVDETYQSPLKKLVGDYKKSKFLAEQEAMRAVTLGQDVVIVNPTAPVGAWDIKPTPT
GDIIVRFLRRQMPVYVDTGLNIIDVRDVAWGHLLALERGKSGDRYILGNQNLTLKELLDL
LQEVTGLPAPRQTIPIWLPLTIAWVDEKILAPLGKQPSIPLDGVRMSQKKMYYDASKAIK
KLGLPQSSIRVALENAINWFDI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttgttactggtgccagtggttttattggggcgaatttagtgcggttgtta
ttacagcagggttatgctgtgcgatcgctagttcgccctacaagtcgtcttgataatctt
cagggtttagatatagaagttgtagtgggagacttaaatgactcctacttgtttgagttg
atagagggatgtcaggttttattccatgtagctgctcattattctttgtggcaaaaagat
aaagagttactttataaaaataatgttttgggtacacgcaatgttttggccgcagcacga
cgggcaaaaattgagcggacagtttatacaagttctgttgctgctattggtgtgggagtt
tctagtacagtcgttgatgaaacttatcagtctccactaaagaagttggtgggagattat
aaaaagtctaagtttttggcagaacaagaggcgatgagagcagttactcttggtcaagat
gtggtaattgttaatcctacagctcctgttggtgcttgggatattaaaccaactccgacg
ggtgatattattgttcgctttttacgtcggcaaatgcctgtttatgtggatactggttta
aatattatagatgttcgagacgtggcatggggacatttattagctttggaaagagggaaa
agtggcgatcgctatattttaggtaatcagaatttgactctgaaggaattacttgattta
ttgcaggaagttacaggtttacctgctccaagacaaactattcctatatggttaccttta
actatcgcgtgggttgatgaaaaaattcttgcacctttgggaaaacaaccttctattccc
ttagatggcgtgcggatgtctcaaaaaaagatgtattatgatgcttctaaggcaataaaa
aaattgggtttgccccagtcttcaattagagttgctcttgagaatgctattaattggttt
gacatttaa

DBGET integrated database retrieval system