KEGG   Trichodesmium erythraeum: Tery_3568Help
Entry
Tery_3568         CDS       T00387                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ter  Trichodesmium erythraeum
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Tery_3568
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Tery_3568
Enzymes [BR:ter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Tery_3568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_3568
CYORF: 
UniProt: 
Position
5484593..5487043
Genome map
AA seq 816 aa AA seqDB search
MNQQNPIPNIPAISWNRPIGLDWDKPYTVRYSSNIDDGPWHGMPLGGFGAGATGRSPRGD
FNLWHLDGGEHIYQNLPACQFSVFEETKGQKQAYALSTELPTDGSLSAWQWYPREKAGLK
TGTYHALYPRSWFVYENVFTAQLSCEQFSPILAGNYQETSYPIAIFEWTAHNPTDEAITL
SIMLSWQNTVGWFTNSVKTPEVRVRDDGSPVYEYKPRWGESTDNFNLLVEDFHRIGCTMT
KLSIADEPAEGEGQMAIATFINAGMEVFYHTRWNPTGTGEDIWHYFALDGSLIDEENELP
ATEGEQIGVAISVRFTIRPGKNRKIPFFLVWDLPVTDFGNGVSYYRRYTDFYGRNGKNAW
SMIRTAMKHYQTWRENIEAWQNPILQREDLPNWLKMALLNELYDLTSGGTIWAAASDSAP
YGQFAVLECLDYRWYESLDVRLYGSFGLLILWPELEKSVLVAFARAVSTADDTLRIIGYN
QVSAVRKVAGATPHDLGAPNEHPWEMTNYTSYQDCNQWKDLSSDFVLQVYRDFLLTGADD
YEFLWQSWSAITETLAYLKGFDKDNDGIPENEGAPDQTFDDWQLRGVSAYCGGLWLAALE
AAIAIGKVLIEHPREIPYYPPKGFYSEVDKNSVDAINNQVYLYQGWLKKGLPIYQEKLWN
GEYYRLDSESNSEVVMADQLSGQFYAKLLNLEDIVPAECALSALKTVYNSCFKNFHNGKF
GAANGVLPDGSPENPNATHPLEVWTGINFGLAAFMVQIGMKKEALEITEVVVGQIYENGL
QFRTPEAITVMGTFRASHYLRAMAIWAIYLVIEAKR
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaaaatcctatccctaacattccagccatatcctggaatcgccccattggt
cttgattgggacaaaccttacacagtccgttatagtagtaatattgatgatggcccatgg
cacggaatgcctctgggaggtttcggtgcaggtgccactggtcgttccccccggggggat
tttaatctttggcatcttgacggtggggagcacatttatcaaaatctgcccgcctgtcaa
tttagcgtttttgaagaaacaaaaggacagaaacaagcttatgctttatctaccgaatta
cccactgatggtagtctatctgcttggcagtggtatcctcgggaaaaagccgggctcaag
actggcacttatcacgctctttacccccgcagctggtttgtttatgagaatgtatttact
gcacaattaagttgtgaacaattttccccaattttggcaggtaactatcaagaaaccagt
tatccgatcgctatatttgaatggactgcccataatcccacagatgaagcaattacactt
agcataatgctaagttggcaaaatactgttggttggtttaccaattctgtgaaaacacca
gaagtgagagtgcgagatgatggtagcccagtttatgaatacaaacctcggtggggagag
agtacagacaactttaacttattagtagaagattttcaccgtattggttgcactatgacc
aaattaagtattgccgacgaacctgcagaaggagaggggcaaatggcgatcgcgactttt
atcaatgccggcatggaagttttctatcatacaaggtggaaccctactggtactggggag
gatatctggcattactttgctctagatggctctctcatagatgaagaaaacgaactacca
gcaactgagggagaacaaattggtgtggctatatcagttcgttttactatcagaccaggg
aaaaacaggaaaattcctttttttttagtttgggatttacctgtgactgactttggtaat
ggggtttcatattaccgccgttatacagatttttatggtcgcaatggcaaaaatgcctgg
tcgatgattcgtactgccatgaagcattatcaaacttggcgggaaaatattgaagcttgg
caaaatccgattttgcaacgggaagatttgcctaattggttgaaaatggctttgttgaat
gaactttatgacctcaccagtggtggaactatttgggcggctgctagcgatagcgctcct
tacggtcagtttgctgttctggaatgtcttgattatcgttggtatgagagtttggatgtt
aggttgtatggttcttttgggttgttaatattgtggccagagttggaaaagtctgtttta
gttgcgtttgcgcgagcagtttcgacagcggatgatacactgagaattattggttacaat
caagtgtcggcagtgagaaaggttgctggagctactccccatgacttgggtgcaccgaat
gagcatccctgggaaatgacaaattataccagttatcaggattgtaatcaatggaaggat
ttatctagtgattttgtattgcaggtatatcgagattttttgttgactggtgcagatgat
tatgagtttctctggcagtcttggtctgctattacggaaactctagcatatcttaagggt
tttgacaaagataatgatggcattcctgaaaatgagggagcgcctgaccaaacttttgat
gattggcagttgcggggtgtgagtgcatattgtggtggactatggctggctgcacttgag
gcagcgatcgctattgggaaagttttaattgagcatcctagggaaattccttattacccg
cctaagggtttctattctgaggttgataaaaattctgtagatgcaattaataatcaggtt
tatttgtatcaaggttggttaaaaaaaggattgcctatttatcaagaaaagttatggaat
ggggaatattatcgtttggatagtgagagtaattcggaagtagtaatggctgatcaatta
tcgggtcaattttatgccaagctgttaaatttggaggatattgtccctgctgaatgtgct
ttgtctgctttaaaaactgtctataattcttgttttaaaaactttcataatggcaagttt
ggtgcggcaaatggggtgttacctgatggttctccagagaatcctaatgctactcatcct
ttagaggtttggacaggaattaattttggtttagcggcttttatggtgcaaattggtatg
aaaaaagaagctctggaaataactgaggtagttgtgggacaaatttatgaaaatggttta
caattccgcactccagaagctattacagtaatgggtacttttagagctagtcattattta
agggcaatggcaatttgggcaatttatttagtcatagaagcaaaaaggtga

DBGET integrated database retrieval system