KEGG   Trichodesmium erythraeum: Tery_3622Help
Entry
Tery_3622         CDS       T00387                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00860  Porphyrin and chlorophyll metabolism
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tery_3622
Enzymes [BR:ter01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Tery_3622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_16 AAA_22 Sigma54_activat AAA_29 AAA DUF815 ABC_tran AAA_18 AAA_30 MMR_HSR1 AAA_28
Motif
Other DBs
NCBI-ProteinID: ABG52692
JGI: Tery3622
CyanoBase: Tery_3622
CYORF: Tery_3622
UniProt: Q10YI2
Position
complement(5567156..5568373)
Genome map
AA seq 405 aa AA seqDB search
MLNCNIDWFSSQDSCFGEHGFSTKIEIKISNYNLEYTVSSTVKANKNVNTSVKSAVPRSR
AVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIKIVVDD
PFNSDPYDPDLMSDSVRDRLVKQEEIPIFTRKVQMVDLPLGATEDRVCGTIDIEKALSEG
VKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISIRHPARFVLV
GSGNPEEGELRPQLLDRFGMHAEIRTVKDPILRVEIVEQRSAFDQNPQGFLGKYTSQQEE
LQNKLVDAQQKLTFVEVDHDLRVKISQVCSELDVDGLRGDIVTNRAAKALAAFEGNTEVS
LEDVGRVITMCLRHRLRKDPLESIDSGDKVKKVFNRVFGLAEVEQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaattgcaatattgattggttttcatcccaagactcctgtttcggtgagcacggg
ttttcaaccaaaattgagataaaaattagtaattataatttagagtatacagtgagttca
accgttaaagccaataaaaatgtaaatacatctgtgaaatcagccgttccaagaagtaga
gctgttttccctttcaccgccattgtcggtcaggaagaaatgaaactggccttactatta
aatgtaattgaccccaaaatagggggggtaatgatcatgggtgatcggggtacaggtaaa
tctaccactatccgtgcattagctgacctgttgccagaaattaaaattgttgttgatgac
ccttttaatagtgatccttatgacccagatttgatgagtgattctgtgcgagatagatta
gtaaagcaggaagaaattccgatttttacaagaaaagtccaaatggtggacttaccattg
ggggcgacggaggatcgggtatgtggtactattgatattgaaaaagctttatcagaaggg
gtgaaagcttttgaaccaggtttactcgcaaaggctaaccgtggtattttgtatgttgac
gaggtcaaccttttggatgaccacttagttgatgtcttgcttgactcggcggcaagtggc
tggaatactgtggaaagagaaggtatttctatacgccatccggctcgttttgtccttgta
ggttcgggaaacccagaagaaggggaattacgacctcagttactggacagatttggaatg
catgctgaaatccgaactgtcaaagatcctatcttaagagttgaaattgttgaacaacgt
tcagcttttgatcaaaatcctcaagggtttttaggaaagtatacatcacaacaggaagaa
ttacaaaataagcttgtagatgctcaacaaaagttgacatttgtggaagttgaccatgat
ttacgggtgaaaatttctcaggtttgttctgagttagatgtagatggtttacggggagat
attgttactaatcgtgctgcaaaagctttagctgcttttgaaggtaatacagaagtgagt
cttgaggatgttggtcgtgttattactatgtgtttacggcatcgactacgaaaagatcct
ttggaaagtattgactctggtgataaggtaaaaaaagtttttaatagagtttttggattg
gcagaagtagaacaatag

DBGET integrated database retrieval system