KEGG   Trichodesmium erythraeum: Tery_3725Help
Entry
Tery_3725         CDS       T00387                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ter  Trichodesmium erythraeum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tery_3725
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Tery_3725
Enzymes [BR:ter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tery_3725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_3725
CYORF: 
UniProt: 
Position
complement(5712913..5713839)
Genome map
AA seq 308 aa AA seqDB search
MLPIIFSLAGTILSEAEKQLFTRSQPAGFILFQRNCEHPTQVKQLTDTLRKCINQKDIPI
LIDQEGGRVARLQPPHWWVAPSASSYLQEINDLNDAAHRAKIDAKHIAQDLQNIGINVNC
SPVLDCPIPEADLVIGTRAYSNSPSEIITMAKAVIEGFQEEGVMPVIKHIPGHGRALVDS
HKALPVVETSLKELSECDFLPFKALAKSVTWAMSAHVIYTAIDSENCATVSPTIIQEIIR
KQIGFEGILVTDDLTMKALSGDLVTKVNRSLKAGCDLALYCDGKLEDMEFLADNITPVKP
ILFSSKIS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgttacctataattttttcactcgctggaacaattttatctgaggctgaaaaacaatta
tttactcgctctcaacctgctggttttattctatttcaacgcaactgtgaacaccctact
caagttaaacaattaactgatactttgagaaaatgtattaaccaaaaagacattcctatc
ttaattgatcaagaaggaggtcgagttgctcgtttacagcctccccattggtgggttgca
ccttctgcttcctcttatcttcaagaaattaatgatcttaatgatgctgcacatagagca
aaaatagatgctaaacacatagctcaagatttacaaaacattggtattaatgttaattgt
tctcctgtacttgattgtcctatacctgaagcggatctagtaattggtacaagagcttat
agtaattcaccttcagaaattatcacaatggctaaagctgttattgaaggttttcaagag
gaaggagttatgcctgtaattaaacacatccccggtcatggtcgtgctttagtagatagt
cataaagctttaccagtggttgaaacttctctaaaagaattatctgaatgtgatttttta
ccttttaaagctttagcaaaatctgttacttgggccatgagcgctcatgttatttatact
gctattgattctgaaaattgtgctactgtttcacctactattatacaagaaattatccgt
aagcaaattggttttgaaggtatattagttactgatgacttaactatgaaggctttatca
ggagatttagttacgaaagttaatcgctcattaaaagcaggttgcgatttagcattatat
tgtgatggcaagttagaagatatggaatttttagcagataatattactcctgtaaaaccg
atattatttagttcaaaaatatcttaa

DBGET integrated database retrieval system