KEGG   Trichodesmium erythraeum: Tery_3725Help
Entry
Tery_3725         CDS       T00387                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ter  Trichodesmium erythraeum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ter00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ter00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_3725
CYORF: 
UniProt: 
Position
complement(5712913..5713839)
Genome map
AA seq 308 aa AA seqDB search
MLPIIFSLAGTILSEAEKQLFTRSQPAGFILFQRNCEHPTQVKQLTDTLRKCINQKDIPI
LIDQEGGRVARLQPPHWWVAPSASSYLQEINDLNDAAHRAKIDAKHIAQDLQNIGINVNC
SPVLDCPIPEADLVIGTRAYSNSPSEIITMAKAVIEGFQEEGVMPVIKHIPGHGRALVDS
HKALPVVETSLKELSECDFLPFKALAKSVTWAMSAHVIYTAIDSENCATVSPTIIQEIIR
KQIGFEGILVTDDLTMKALSGDLVTKVNRSLKAGCDLALYCDGKLEDMEFLADNITPVKP
ILFSSKIS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgttacctataattttttcactcgctggaacaattttatctgaggctgaaaaacaatta
tttactcgctctcaacctgctggttttattctatttcaacgcaactgtgaacaccctact
caagttaaacaattaactgatactttgagaaaatgtattaaccaaaaagacattcctatc
ttaattgatcaagaaggaggtcgagttgctcgtttacagcctccccattggtgggttgca
ccttctgcttcctcttatcttcaagaaattaatgatcttaatgatgctgcacatagagca
aaaatagatgctaaacacatagctcaagatttacaaaacattggtattaatgttaattgt
tctcctgtacttgattgtcctatacctgaagcggatctagtaattggtacaagagcttat
agtaattcaccttcagaaattatcacaatggctaaagctgttattgaaggttttcaagag
gaaggagttatgcctgtaattaaacacatccccggtcatggtcgtgctttagtagatagt
cataaagctttaccagtggttgaaacttctctaaaagaattatctgaatgtgatttttta
ccttttaaagctttagcaaaatctgttacttgggccatgagcgctcatgttatttatact
gctattgattctgaaaattgtgctactgtttcacctactattatacaagaaattatccgt
aagcaaattggttttgaaggtatattagttactgatgacttaactatgaaggctttatca
ggagatttagttacgaaagttaatcgctcattaaaagcaggttgcgatttagcattatat
tgtgatggcaagttagaagatatggaatttttagcagataatattactcctgtaaaaccg
atattatttagttcaaaaatatcttaa

DBGET integrated database retrieval system