KEGG   Trichodesmium erythraeum: Tery_3780Help
Entry
Tery_3780         CDS       T00387                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ter  Trichodesmium erythraeum
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tery_3780
Enzymes [BR:ter01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Tery_3780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_3780
CYORF: 
UniProt: 
Position
complement(5810073..5810984)
Genome map
AA seq 303 aa AA seqDB search
MSTIYSTLLLPFIGSEIEPDYTTAKVVIVPIPYEATTTYRRGCVNGPAVLLNASQQLECY
DEELDRETGLEVGIYTHEPIADTRNGKKITPLDMLKVTQETVEKLVSDGKFVIAIGGEHS
ITNGIVKAYKKLYFDEPFTVIQIDAHGDLRYEYEGSIYNHACVMRRIFEMGLPMVQIGIR
AICKEEADLIKDKNLTVFKAREIAIQPDWMERVISSIQTKNVFLTIDLDGIDPTLIPGVG
TPEPGGLNWYSLTTFLRRIFELYQVLGCDIMELAPITDSVVSEFTAAKLVYKLVGYQALA
QDW
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaatttactctaccttgcttctaccattcattggttcagaaattgagccagat
tacactaccgctaaagtagtaattgtaccaattccttatgaggcaactactacttataga
agaggttgtgttaatggtccagcagtattattaaatgcatctcaacagttagaatgttat
gacgaagaattagatagggaaacaggtttggaagttggtatctatactcacgaacctata
gcagatactcgtaatggaaaaaaaattactccattagatatgctaaaagtaactcaagaa
acagtggaaaaattagttagtgatggaaagtttgtgattgctataggtggagaacatagt
attacaaatgggatagtaaaagcttataaaaaattatattttgatgaaccttttaccgtg
attcaaatagatgctcatggagatttgcgatatgaatatgaaggttcaatatataatcat
gcctgtgtaatgcggcggatatttgagatggggttaccaatggtacaaataggtattcgg
gcaatttgtaaagaagaagctgatttaataaaggataaaaatttaactgtttttaaagca
agagaaatagctattcagccagattggatggaaagagtaatctctagtattcagactaaa
aatgtgtttttaacgatagatttagatggaattgacccaacattaattcctggagttggc
acaccagaaccaggaggactaaattggtattctttaactacatttttacgaagaatattt
gaattatatcaagtattaggttgtgacattatggagttggctccaattactgattcggta
gtatctgagtttactgcagcaaaattagtttataaacttgttggttatcaagcattagct
caagactggtag

DBGET integrated database retrieval system