KEGG   Trichodesmium erythraeum: Tery_3810Help
Entry
Tery_3810         CDS       T00387                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ter00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_3810
CYORF: 
UniProt: 
Position
5858754..5860268
Genome map
AA seq 504 aa AA seqDB search
MTTNTEKYILALDLGTTGNRAILFNSQGASVAQAYKELSQYYPHPGWLEHNAEEIWEDTY
AMIKDVFRDTGVSSSNVEAIGLTVQRETCLLWDKTTGKPLHKAIVWQDRRTASLCQELAA
KGEAEKIKTRTGLVLDAYFSATKLSWLLDWVKEEKPNLDLKNVLAGTIDTWVLWKLTGGK
VHATDHSNASRTMLMNIESLNWDQELLDLFQIPREMMPQIQPSFSIFGKSEPDLLGGSIP
IAAVLGDQQAALFAHGCNFPGMSKCTYGTGSFLIANTGNHVTKSQNQLLSTIAWTQLVKG
KLQATYALEGAMFTTGACIQWLRDGIKLIDSVAETENLALQVEDTNGVYFVPALSGLGAP
HWDMDARGAILGITGGVQRENIIRAVLESIAFQVKEVVDAVNKDSGIPMSHLKVDGGVSQ
NNFLMQYQANLLGIPVERPAFIDATAQGAAFAAGLTIGLWNNYQKLLSNNKVGQVFEPNK
NATKVQESFVVWQKAVSRAKNWIN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaacacagaaaaatatattcttgctcttgacctcggtaccactggtaaccga
gcaatattattcaattctcaaggtgctagtgtcgctcaagcatataaagaactctcccaa
tattatccacacccaggctggttagagcataatgccgaagaaatatgggaagacacttat
gcaatgatcaaggatgttttccgagatactggtgtttccagctctaatgtggaagcgatc
ggtttaacagtacaacgagaaacctgtctcctctgggataaaactacaggcaaacccctt
cacaaagccattgtttggcaagaccgtcgcaccgcatctttatgtcaagagttagcagca
aaaggtgaagcagaaaaaatcaaaacgcgcaccggattagttttagatgcttacttttca
gctactaaactatcatggttgctagactgggtcaaggaagaaaaacctaatcttgacctc
aaaaatgttttagcaggtaccattgatacttgggttttgtggaaactaactggtggaaaa
gttcatgctactgaccacagtaacgccagtcgtacaatgttaatgaatatcgaatctcta
aattgggaccaggaattattagacctgtttcaaattcctagagaaatgatgccacaaatt
caacctagtttcagtatatttggcaagagtgaaccagatttattaggtggatcaattccc
attgctgcagtcttaggagaccaacaagctgctttatttgctcatggttgcaatttccca
ggaatgtcaaaatgcacctatggtacaggtagcttcttaattgcaaatactggaaatcat
gtcaccaaatcgcaaaatcaattattatcaactatagcttggactcagttagtcaaaggg
aaactgcaagcaacttatgctttagaaggagcaatgtttactacgggagcttgtattcag
tggttgcgcgacgggataaaattaattgactctgtggcagaaacagaaaatttagcttta
caagtggaagacactaatggtgtttattttgtacctgctttaagtggtcttggcgcgccc
cactgggatatggatgctcgtggtgcaattttgggaattactgggggagtgcagcgagaa
aatattatcagagcagttttggagtcaattgcttttcaagtaaaagaggttgtggatgca
gtgaataaggatagcggaattcctatgagtcatttgaaagttgatggtggagtttcgcag
aataattttttaatgcaatatcaggcgaatttgttgggtattccagttgaacgccctgct
tttattgatgcgactgctcaaggcgctgcttttgctgctggtctcacaataggtttatgg
aataattatcagaaattgctgagtaataataaagtaggacaggtgtttgaacctaataaa
aatgcgaccaaagtacaagaaagttttgtggtttggcaaaaagcagttagtagagccaaa
aattggattaattaa

DBGET integrated database retrieval system