KEGG   Trichodesmium erythraeum: Tery_3957Help
Entry
Tery_3957         CDS       T00387                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing) (EC:6.3.5.10)
  KO
K02232  
adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ter  Trichodesmium erythraeum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tery_3957
Enzymes [BR:ter01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Tery_3957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_3957
CYORF: 
UniProt: 
Position
complement(6118318..6119784)
Genome map
AA seq 488 aa AA seqDB search
MKAIMVVGTTSHAGKSLITTAICRILSRRGWKVTPFKGQNMALNSYVTSTGGEMGHAQAV
QAWAAGVTPAIEMNPILLKPQGDMTSQVIIKGKASGTVGAVDYYQQYFDIGWNAIQESLE
TLSQEFNMIVCEGAGSPAEINLKHRDLTNMRVAKHLNASTILVVDIDRGGAFAHIIGTLE
LLEPEERNLIKGIVINKFRGQRSLLDSGIHWLEKKTNIPVIGVIPWINEAFPAEDSLSIL
EQRYNKHTTDITIAIIRLPRISNFTDFEPLEAESSVKIKYIHPNDSLGDPDAIIIPGTKT
TINDLLVLQKSGMAEAIKSYQSSGGIVMGICGGFQMLGEVLIDSQGLEGKQGEYKGLELL
PLITTITPKKIASQRQVIANYPLGNLPVIGYEIHQGRTIVTKPDIVKPLFNDYDLGFVDS
YDSIWGNYLHGIFDNGSWRRSWLNILRHKRGLNSLPTSISNYREQREIILDSIADKVNEH
LDLKPVLT
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattatggtagtgggaactacttcccatgccggaaaatctctaattactaca
gccatctgtagaattttatcacgtcgtggttggaaagtcacccccttcaaaggacaaaat
atggctttgaactcctatgtcacatctaccggtggagaaatgggtcatgctcaagcagta
caagcttgggccgcaggtgtaactcctgcaatagaaatgaacccaattttattaaagcct
caaggagatatgacttctcaagttattattaaaggaaaagctagtggtactgtaggagct
gtagattattatcagcagtattttgatattggttggaatgccatccaagaatctttagaa
actttatctcaagagtttaacatgatagtttgtgaaggagccggtagtccagcagaaata
aatctgaagcaccgagatctaactaatatgcgagtcgccaaacatttgaatgcctctaca
attttagtagttgatattgaccgaggaggtgcttttgctcatattattggtacattagaa
ttactagaaccagaagaaagaaatttaatcaaaggaatagtaattaacaaatttagagga
caaagatctctcttagactcaggtattcactggttagaaaaaaaaactaatattcctgta
ataggtgtcattccttggattaatgaagcctttcccgcagaagattctttgagtatttta
gaacaacgttataataaacatacaactgatattacaattgctatcattagattaccaaga
atttctaattttactgattttgaacctttagaagcagagtctagtgtcaaaattaaatat
attcatcctaatgatagtttgggtgatcctgatgccataattatccctggtactaaaact
actataaacgatttattagtattacaaaaaagtggtatggcagaagccatcaaatcttac
caaagttctggtggtatagtaatgggaatttgtggtggatttcaaatgcttggtgaagtt
ttaattgactctcaaggtttagaaggaaaacaaggagaatataaaggattagaattacta
cccttaataactacaattactcctaaaaaaattgccagtcagcgacaagttattgctaat
tatcccttaggaaatttaccagtcataggttatgaaattcatcaaggtagaactatagtt
acaaaaccagatatagttaagcctttatttaatgactatgatttgggttttgtcgatagt
tatgattctatctggggaaactatttacatggaatatttgataatggttcttggcgtcgt
tcttggttaaatatcctacgtcacaaacggggattaaacagtttaccaactagtatttct
aattatagagaacaacgagaaattattttagattcaatcgcagataaagttaatgagcat
ctagatttaaaaccagttttaacataa

DBGET integrated database retrieval system