KEGG   Trichodesmium erythraeum: Tery_4030Help
Entry
Tery_4030         CDS       T00387                                 

Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase (NADP+)
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_4030
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tery_4030
Enzymes [BR:ter01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Tery_4030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_4030
CYORF: 
UniProt: 
Position
6231721..6232740
Genome map
AA seq 339 aa AA seqDB search
MIRVAINGFGRIGRNFLRCLLTRTDSQLDLVAVNDTSDPKTNAHLLKYDSMLGTLKDVDI
STDENSITVNGKTIKCVSDRNPLNLPWADWGIDLIIESTGVFVTEEGASKHLQAGAKKVL
ITAPGKGGQIGTFVVGVNHQDYKHEDYNIISNASCTTNCLAPIVKVIHDNFGIIKGTMTT
THSYTGDQRILDASHRDVRRARAAAVNIVPTSTGAAKAVALVIPEMKGKLNGIAMRVPTP
NVSVVDLVAQVEKKTFVEQVNEVMEVAAKGPMKGIIEYSDLPLVSIDYRGHDCSSIVDAS
LTMVMDGDMVKVIAWYDNEWGYSQRVVDLAEVVAQNWAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagttgccataaatggttttggacgtattggacggaattttttacgttgcttg
cttactcgtacagatagtcaactcgatcttgtagctgttaatgatacttctgaccccaaa
accaatgctcatctgctaaagtatgactcaatgttgggtactttaaaagatgtagatatt
agtacggatgaaaattctattacagtcaatggtaaaacaattaaatgtgtttctgaccgt
aatcctttaaatttaccatgggcagactggggtattgacttaattattgaatctacaggt
gtatttgtgactgaggaaggagcttcaaagcatttacaggctggagctaaaaaggtttta
attactgctcctggtaagggtggacaaattggtacttttgtagtaggtgttaatcatcag
gattataagcatgaagattacaatattatcagtaatgctagctgtacaactaattgtcta
gctcctattgtcaaggtcatccatgacaactttggtattatcaaaggtacaatgactaca
actcacagttatacaggcgaccaacgtattttggatgctagccacagagatgtacgaaga
gccagggctgcggcggtaaatattgtgccaacttctacaggtgcagctaaagcagtagct
ctagtaattccagaaatgaaaggtaaattaaatggtattgcgatgcgtgttcctactcct
aacgtttctgtggtagatttggttgctcaagttgagaaaaagacatttgttgaacaggta
aatgaagttatggaggtggctgctaaagggccaatgaagggaatcattgaatacagtgat
ttacctttagtttctatcgactatcgtggccatgattgctcttcaattgttgatgctagc
ctgacaatggttatggatggggatatggtaaaagttattgcttggtatgataatgagtgg
ggttacagtcagcgtgttgtagacttggctgaagttgtagcacagaattgggctgcctag

DBGET integrated database retrieval system