KEGG   Trichodesmium erythraeum: Tery_4030Help
Entry
Tery_4030         CDS       T00387                                 

Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase (NADP+)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00010  Glycolysis / Gluconeogenesis
ter00710  Carbon fixation in photosynthetic organisms
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
ter01120  Microbial metabolism in diverse environments
ter01130  Biosynthesis of antibiotics
ter01200  Carbon metabolism
ter01230  Biosynthesis of amino acids
Module
ter_M00002  Glycolysis, core module involving three-carbon compounds
ter_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ter_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ter_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_4030
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tery_4030
Enzymes [BR:ter01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Tery_4030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N Mannitol_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABG53048
JGI: Tery4030
CyanoBase: Tery_4030
CYORF: Tery_4030
UniProt: Q10XH6
Position
6231721..6232740
Genome map
AA seq 339 aa AA seqDB search
MIRVAINGFGRIGRNFLRCLLTRTDSQLDLVAVNDTSDPKTNAHLLKYDSMLGTLKDVDI
STDENSITVNGKTIKCVSDRNPLNLPWADWGIDLIIESTGVFVTEEGASKHLQAGAKKVL
ITAPGKGGQIGTFVVGVNHQDYKHEDYNIISNASCTTNCLAPIVKVIHDNFGIIKGTMTT
THSYTGDQRILDASHRDVRRARAAAVNIVPTSTGAAKAVALVIPEMKGKLNGIAMRVPTP
NVSVVDLVAQVEKKTFVEQVNEVMEVAAKGPMKGIIEYSDLPLVSIDYRGHDCSSIVDAS
LTMVMDGDMVKVIAWYDNEWGYSQRVVDLAEVVAQNWAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagttgccataaatggttttggacgtattggacggaattttttacgttgcttg
cttactcgtacagatagtcaactcgatcttgtagctgttaatgatacttctgaccccaaa
accaatgctcatctgctaaagtatgactcaatgttgggtactttaaaagatgtagatatt
agtacggatgaaaattctattacagtcaatggtaaaacaattaaatgtgtttctgaccgt
aatcctttaaatttaccatgggcagactggggtattgacttaattattgaatctacaggt
gtatttgtgactgaggaaggagcttcaaagcatttacaggctggagctaaaaaggtttta
attactgctcctggtaagggtggacaaattggtacttttgtagtaggtgttaatcatcag
gattataagcatgaagattacaatattatcagtaatgctagctgtacaactaattgtcta
gctcctattgtcaaggtcatccatgacaactttggtattatcaaaggtacaatgactaca
actcacagttatacaggcgaccaacgtattttggatgctagccacagagatgtacgaaga
gccagggctgcggcggtaaatattgtgccaacttctacaggtgcagctaaagcagtagct
ctagtaattccagaaatgaaaggtaaattaaatggtattgcgatgcgtgttcctactcct
aacgtttctgtggtagatttggttgctcaagttgagaaaaagacatttgttgaacaggta
aatgaagttatggaggtggctgctaaagggccaatgaagggaatcattgaatacagtgat
ttacctttagtttctatcgactatcgtggccatgattgctcttcaattgttgatgctagc
ctgacaatggttatggatggggatatggtaaaagttattgcttggtatgataatgagtgg
ggttacagtcagcgtgttgtagacttggctgaagttgtagcacagaattgggctgcctag

DBGET integrated database retrieval system