KEGG   Trichodesmium erythraeum: Tery_4178Help
Entry
Tery_4178         CDS       T00387                                 

Definition
phage related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ter  Trichodesmium erythraeum
Brite
Enzymes [BR:ter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Tery_4178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4178
CYORF: 
UniProt: 
Position
6440262..6440552
Genome map
AA seq 96 aa AA seqDB search
MQVSQNCLDLIKKWEGFSLNAYIDPVGIATIGYGSIRYPNGEKVRLGDRISERDAEGYLG
FECKKIALEISKLIKVPVNQNQFDALVSFSYVRLVG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtctcacaaaattgcctagatttaatcaaaaaatgggaaggattttctctgaat
gcttatatagatccagtaggaatagcaactattgggtatggaagcattcgttatcccaat
ggagaaaaagttcgtctaggagatagaatttcagaaagagatgcagaaggatatctgggt
tttgaatgtaagaaaatagcactagaaatttctaaattaatcaaagttcctgttaatcaa
aaccaatttgatgctctagtatctttttcttatgtgcgactcgttggctag

DBGET integrated database retrieval system