KEGG   Trichodesmium erythraeum: Tery_4180Help
Entry
Tery_4180         CDS       T00387                                 

Definition
peptidoglycan binding domain-containing protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ter  Trichodesmium erythraeum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4180
CYORF: 
UniProt: 
Position
6441892..6443136
Genome map
AA seq 414 aa AA seqDB search
MIGNGFAEFNNVGTGAFQSSTLLKKLNQGDYQGAANEFSRWVNGVVNGVKQSLPGLVSRR
ADEKRLFLKAGGEKKPLEDEISKQDKVTWLEGYRDENKKTVVVAWNGGKVEEILTLEKFN
KELLANVFPQYKNARYYVTAPGNKRIPPGERISVFEISDIYNSDKLPKLNRVLVRGSEGS
DVKILQERLKDLGYYLGELDAIFGRQTELAVIDFKKDYFGITTDNATVESITWKKLWGDP
LPKPPVLPPTSKKNYLLLTKTSRKDRYGCYVLHLDYFKSGKLEDRLEVCCGAPGRQFFRT
AARSRAMTGEPLPEGKWYINDIIWADGQDNYYGQIFQSGIGPVTVPLDYIEPGTTERSAI
EIHIDWNRNYGSPGTVGCIATYNIADYKRFITWLRDTDPRDLYVDWKLGTSPKP
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggaaatgggtttgctgagtttaacaatgtaggaactggcgcatttcaaagtagt
accttattaaaaaaactaaatcaaggagattatcaaggagcagctaatgaattttctcgt
tgggtaaatggggtggttaatggtgtcaagcaatcactacctggtttagtatctcgtcgt
gctgatgaaaagaggttatttcttaaagctggaggagagaaaaaacctttagaagatgaa
atttccaaacaagataaagtaacttggttagaaggatatcgtgatgaaaataagaaaact
gtagttgtagcttggaatgggggtaaagtagaagaaattttaactctagaaaagtttaat
aaagagttattggctaatgtttttcctcagtataaaaatgctaggtattatgtcactgct
cctggtaataaacgaattcctcctggtgaaagaatttcagtttttgaaatttcggatata
tataattctgataaacttccaaaactcaatcgtgtactagtgcgagggagtgaaggtagt
gatgtgaaaattttacaagagagattgaaggatttaggttattatctaggagaacttgat
gctatttttggtaggcaaactgagcttgcagttattgattttaaaaaagattattttgga
atcacaacagataatgcaacagtagagtccataacttggaaaaaattatggggagatcct
ctacctaaacctcccgtcttaccacccacgtcaaagaaaaattatctactattaacaaag
acaagtcgtaaagatagatatggatgttatgtacttcacttagactattttaaaagtggc
aagctagaggacaggttagaagtttgttgcggtgcccctggaaggcaatttttccgtacc
gctgctcggagtcgggcaatgactggagaaccattaccagagggaaagtggtacattaat
gatattatttgggctgatggtcaagataattattatggtcaaatttttcaaagtggtatt
ggccctgtaacagttcccttagactatatagaacctggcacaactgaaagaagcgcgatt
gaaattcatattgactggaatcgaaattatggttctcctggtactgttggttgtatagct
acttacaacatagctgattataaaaggtttattacttggttaagggatacagatccacgg
gatctttatgttgactggaaattagggacttctcctaaaccttag

DBGET integrated database retrieval system