KEGG   Trichodesmium erythraeum: Tery_4227Help
Entry
Tery_4227         CDS       T00387                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ter  Trichodesmium erythraeum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ter00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tery_4227
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Tery_4227
Enzymes [BR:ter01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Tery_4227
Two-component system [BR:ter02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Tery_4227
Bacterial motility proteins [BR:ter02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Tery_4227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4227
CYORF: 
UniProt: 
Position
6523084..6524142
Genome map
AA seq 352 aa AA seqDB search
MPKFRILIVDDSVIVRRIINNILSESDWIEVVGVAPSGQIALAKIPQVNPDLIILDVEMP
EIDGLETLKRIRQTYKQLPVIMFSAITQRGAIATLDALTLGANDYITKPANMGSKEKAIE
YIRKQLIPKIQVFCHRKVSLTKHCLAPSMTSFQRKTSTQLLTLKLEIVAIGVSTGGPQAL
YQLLHKFPASFRVPIVIVQHMPPVFTTRLAERLSSQCKIPVHEAKDRDVIKSGEAWIAPG
NYHIILVREGKQVRIQTIQTPPENSCRPAVDVLFRSVAKLYQGAVLGVVLTGMGQDGLHG
CTSIREMGGQVLVQDQASSVIWGMPGMVANAGLADQILPLNKLAEEIIRRIG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaattccgtatcctgattgttgatgattcggtaattgttcgccgaattatcaat
aatatcctatctgagtcagattggatagaagtagtgggtgtagccccaagtggccaaatt
gctttagcaaagattcctcaagttaaccctgatctgatcatacttgatgtggaaatgcca
gaaatagatggtttagaaactttaaaaagaattcgacaaacctacaagcaacttccagtg
attatgtttagtgctattactcaacgtggggcaatagcaacattggatgccctgacttta
ggagctaatgactatattactaaacctgctaatatgggcagcaaagagaaagccattgaa
tacatcagaaaacagttgattcctaaaattcaagttttctgtcaccgtaaagttagttta
acaaaacattgcttggccccatctatgacttcttttcagagaaagacttctactcagctg
ttgaccttgaaattagaaattgtcgctattggagtttctacaggaggacctcaggcttta
tatcagcttttacataagtttcccgccagctttcgggttcctattgttattgttcaacat
atgcctcctgtttttactactcggttagctgaaaggttgtcttctcaatgtaagattcct
gtgcatgaagcaaaagacagagatgtgattaaatctggagaagcttggattgcaccaggg
aattatcatattattttagtgagggaaggtaaacaagttcgtattcagaccatacaaacc
cctcctgaaaactcctgtcgtccagcggtggatgttttatttcgttcagtagctaaactt
tatcaaggtgctgtacttggggttgtattaacaggcatgggccaagatggactccatggt
tgtacttctattcgtgaaatgggaggacaagttttagtccaagatcaagctagtagtgtg
atctggggaatgccaggaatggttgctaatgcgggacttgctgatcagattttaccttta
aataaattagctgaagagattatccgtaggattggttga

DBGET integrated database retrieval system