KEGG   Trichodesmium erythraeum: Tery_4278Help
Entry
Tery_4278         CDS       T00387                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00250  Alanine, aspartate and glutamate metabolism
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tery_4278
Enzymes [BR:ter01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Tery_4278
Peptidases [BR:ter01002]
 Cysteine Peptidases
  Family C44
   Tery_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase
Motif
Other DBs
NCBI-ProteinID: ABG53275
JGI: Tery4278
CyanoBase: Tery_4278
CYORF: Tery_4278
UniProt: Q10WU9
Position
6599355..6599810
Genome map
AA seq 151 aa AA seqDB search
MKRSLHCNFITTYTGTPKFKSADHILTKVNNMTRANKLIGLSPLFDQRIVELSLEILPKY
KLSGADEKAVLKQAVADLLPEKILTRPKSGMMVPVNFWFRKIWQRRTKNLLLSKKAAIAP
YINQDLIKDWLNYQGDTWRRYGIKLWLLVSL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgatcgcttcactgtaattttatcactacatatacaggaacacctaaatttaaa
agtgcagaccatattttaaccaaagtaaataacatgactagggcgaataaattaatcgga
ctttccccattatttgaccaaagaattgtagaactaagtttagaaattctaccaaaatat
aaattatccggcgcagatgaaaaagcagtattaaaacaagcagtagcagacctattacca
gagaaaatattaacccgtcccaaaagtggaatgatggtacctgttaacttttggtttcgt
aaaatatggcagcgtcgaaccaagaatttattgttaagtaaaaaagcagcgatcgctccc
tatatcaatcaagatttaatcaaagattggttaaattatcagggagatacttggaggcgt
tatggaattaaactttggttattagttagcctataa

DBGET integrated database retrieval system