KEGG   Trichodesmium erythraeum: Tery_4278Help
Entry
Tery_4278         CDS       T00387                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ter  Trichodesmium erythraeum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tery_4278
Enzymes [BR:ter01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Tery_4278
Peptidases [BR:ter01002]
 Cysteine Peptidases
  Family C44
   Tery_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4278
CYORF: 
UniProt: 
Position
6599355..6599810
Genome map
AA seq 151 aa AA seqDB search
MKRSLHCNFITTYTGTPKFKSADHILTKVNNMTRANKLIGLSPLFDQRIVELSLEILPKY
KLSGADEKAVLKQAVADLLPEKILTRPKSGMMVPVNFWFRKIWQRRTKNLLLSKKAAIAP
YINQDLIKDWLNYQGDTWRRYGIKLWLLVSL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgatcgcttcactgtaattttatcactacatatacaggaacacctaaatttaaa
agtgcagaccatattttaaccaaagtaaataacatgactagggcgaataaattaatcgga
ctttccccattatttgaccaaagaattgtagaactaagtttagaaattctaccaaaatat
aaattatccggcgcagatgaaaaagcagtattaaaacaagcagtagcagacctattacca
gagaaaatattaacccgtcccaaaagtggaatgatggtacctgttaacttttggtttcgt
aaaatatggcagcgtcgaaccaagaatttattgttaagtaaaaaagcagcgatcgctccc
tatatcaatcaagatttaatcaaagattggttaaattatcagggagatacttggaggcgt
tatggaattaaactttggttattagttagcctataa

DBGET integrated database retrieval system