KEGG   Trichodesmium erythraeum: Tery_4348Help
Entry
Tery_4348         CDS       T00387                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tery_4348
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tery_4348
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tery_4348
Enzymes [BR:ter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tery_4348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4348
CYORF: 
UniProt: 
Position
6703129..6704442
Genome map
AA seq 437 aa AA seqDB search
MTHATKTHNQIETTNTAVENLRCKECGEEYPLEAKHICEDVCFGPLEVKYNYEKLSQIVS
RATIEAGPKSIWRYRHFLPVVTDNFIDVGTGMTPLVKSERLARRLGLKNLYIKNDAVNMP
TLSFKDRVVSVALSRARELGFSTVSCASTGNLANSTAAIAAKAGLECCVFIPADLEAGKV
LGTLIYNPTLMAVKGNYDQVNRLCCEVANSYGWGFVNINLRPYYSEGSKTLGFEVAEQLG
WQLPDHVVAPIASGSLYTKIYKGFQEFIKVGLVEDKAVRFSGAQAEGCSPVAQAFKEERD
FISPVKPNTIAKSIAIGNPADGVYALELARKTNGNIESVNDTEIIEGIKLLAETEGIFTE
TAGGTTIAVLKKLVEAGKIDPEETTVVYITGNGLKTQEAVQGYVGEPLTIEAKLDSFERA
WERAQTLERLDWQQVLV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgccacaaaaactcataaccaaatcgaaacgacaaacacagccgtagaaaac
cttagatgcaaagaatgtggagaagaataccccttagaagcaaaacacatatgtgaagac
gtgtgctttggccctttagaagttaaatataattacgaaaagctctctcaaatagtaagt
agggccacaatagaagcaggccctaagtctatctggcgttatcgacatttcctaccagtg
gtaacagacaactttatagatgtaggaacaggtatgactcccctcgtaaaatcagaacgt
ttagcacgtcgcctgggtctaaaaaatctctatattaaaaatgatgcagtaaatatgcct
acccttagtttcaaagatagggtagtatcagtggccttaagtcgcgctagagaattaggt
ttctctacagtatcttgtgcaagtacaggtaacctagctaactctaccgcagcgatcgcg
gccaaagctggattagaatgttgtgtatttattcctgctgacttagaagcaggaaaagtt
cttggtaccttaatttacaacccaacactcatggcagttaaagggaactatgaccaagta
aaccgcctttgttgcgaagtagcaaatagctacggttggggctttgtaaatattaatctc
cgcccatattattcagaaggttcaaaaactcttggttttgaagttgctgaacaactagga
tggcaactaccagatcatgtggttgctcctattgcttctggttccctttacaccaaaatt
tacaaagggttccaagagtttatcaaagtaggtttagtggaagataaggcagttcgtttt
agtggagcccaagctgaaggttgttcaccagtagctcaagcatttaaggaggagcgtgat
tttatatcaccagttaaacctaatactattgctaagtcaattgctattggcaacccggca
gatggtgtctacgcactagagttagctcgtaaaacaaatggtaacattgaatctgtgaat
gatactgagattattgaaggtataaaattattagcagaaacagaaggtatatttacagaa
acagcgggtggtacaactattgctgtattgaaaaagttagtagaggcaggtaaaattgac
cctgaagagactactgttgtttacattacaggcaatggcttaaagactcaagaagcagta
caaggttatgtcggcgaacctttaacaatagaagcaaagctggatagttttgaaagagca
tgggaacgcgctcaaacattagaacgtcttgactggcaacaagttttggtttaa

DBGET integrated database retrieval system