KEGG   Trichodesmium erythraeum: Tery_4348Help
Entry
Tery_4348         CDS       T00387                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tery_4348
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tery_4348
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tery_4348
Enzymes [BR:ter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tery_4348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4348
CYORF: 
UniProt: 
Position
6703129..6704442
Genome map
AA seq 437 aa AA seqDB search
MTHATKTHNQIETTNTAVENLRCKECGEEYPLEAKHICEDVCFGPLEVKYNYEKLSQIVS
RATIEAGPKSIWRYRHFLPVVTDNFIDVGTGMTPLVKSERLARRLGLKNLYIKNDAVNMP
TLSFKDRVVSVALSRARELGFSTVSCASTGNLANSTAAIAAKAGLECCVFIPADLEAGKV
LGTLIYNPTLMAVKGNYDQVNRLCCEVANSYGWGFVNINLRPYYSEGSKTLGFEVAEQLG
WQLPDHVVAPIASGSLYTKIYKGFQEFIKVGLVEDKAVRFSGAQAEGCSPVAQAFKEERD
FISPVKPNTIAKSIAIGNPADGVYALELARKTNGNIESVNDTEIIEGIKLLAETEGIFTE
TAGGTTIAVLKKLVEAGKIDPEETTVVYITGNGLKTQEAVQGYVGEPLTIEAKLDSFERA
WERAQTLERLDWQQVLV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgccacaaaaactcataaccaaatcgaaacgacaaacacagccgtagaaaac
cttagatgcaaagaatgtggagaagaataccccttagaagcaaaacacatatgtgaagac
gtgtgctttggccctttagaagttaaatataattacgaaaagctctctcaaatagtaagt
agggccacaatagaagcaggccctaagtctatctggcgttatcgacatttcctaccagtg
gtaacagacaactttatagatgtaggaacaggtatgactcccctcgtaaaatcagaacgt
ttagcacgtcgcctgggtctaaaaaatctctatattaaaaatgatgcagtaaatatgcct
acccttagtttcaaagatagggtagtatcagtggccttaagtcgcgctagagaattaggt
ttctctacagtatcttgtgcaagtacaggtaacctagctaactctaccgcagcgatcgcg
gccaaagctggattagaatgttgtgtatttattcctgctgacttagaagcaggaaaagtt
cttggtaccttaatttacaacccaacactcatggcagttaaagggaactatgaccaagta
aaccgcctttgttgcgaagtagcaaatagctacggttggggctttgtaaatattaatctc
cgcccatattattcagaaggttcaaaaactcttggttttgaagttgctgaacaactagga
tggcaactaccagatcatgtggttgctcctattgcttctggttccctttacaccaaaatt
tacaaagggttccaagagtttatcaaagtaggtttagtggaagataaggcagttcgtttt
agtggagcccaagctgaaggttgttcaccagtagctcaagcatttaaggaggagcgtgat
tttatatcaccagttaaacctaatactattgctaagtcaattgctattggcaacccggca
gatggtgtctacgcactagagttagctcgtaaaacaaatggtaacattgaatctgtgaat
gatactgagattattgaaggtataaaattattagcagaaacagaaggtatatttacagaa
acagcgggtggtacaactattgctgtattgaaaaagttagtagaggcaggtaaaattgac
cctgaagagactactgttgtttacattacaggcaatggcttaaagactcaagaagcagta
caaggttatgtcggcgaacctttaacaatagaagcaaagctggatagttttgaaagagca
tgggaacgcgctcaaacattagaacgtcttgactggcaacaagttttggtttaa

DBGET integrated database retrieval system