KEGG   Trichodesmium erythraeum: Tery_4368Help
Entry
Tery_4368         CDS       T00387                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00240  Pyrimidine metabolism
ter00250  Alanine, aspartate and glutamate metabolism
ter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tery_4368
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tery_4368
Enzymes [BR:ter01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tery_4368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABG53360
JGI: Tery4368
CyanoBase: Tery_4368
CYORF: Tery_4368
UniProt: Q10WL4
Position
6735476..6736471
Genome map
AA seq 331 aa AA seqDB search
MSTNIWTPRHILSLAEFTPTEYNIILQTATSFQEVLGRRMKKVPALQGQVVANLFFEPST
RTRNSFELAAKRLSADTLNFAPGTSSLTKGETILDTAMTYLAMGTDMMVIRHRNAGVPAA
IASAMDRNGHQVRVLNAGDGQHEHPSQALLDLFTICKLLNSTEPRIELLETKKIAIVGDI
LHSRVARSNIWSLTASGAEVHLAGTPTLLPKYFGEFGKLRPSKLFVHWDIEPALEKADFV
MTLRLQKERMSQHLLPSLREYHQLFGITRDRLKLCQPGVKILHPGPVNRGVEISSDLMDD
PQLSLISQQVTSGIAVRMALLYLLGGGKADQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaacatctggactcctcgtcatatcctctctctagcagaatttacacccact
gaatacaacatcatattacaaacagcaaccagttttcaagaagttctgggtcgccgaatg
aaaaaagtacctgcattacaaggtcaagtagtagcaaatttattctttgaaccctcaaca
cgcactcgtaatagttttgaattagctgccaaacgcttatctgcagataccctaaatttt
gctccaggaacctcctctcttactaagggagaaactattcttgatacagcaatgacctat
ctagcaatgggaacagatatgatggtcatccgacatcgaaatgcaggagttccagcagcg
atcgcctctgccatggatcgaaacggtcatcaagttcgagttcttaatgctggagacggt
caacacgaacatccttctcaagctttactggacctatttactatttgtaaattattaaat
tcaactgaacccagaatagaacttttagaaacaaaaaaaattgctattgtaggagatatt
ttgcactctagagtagcacgatctaatatttggagtttaacagcttctggtgcagaagta
catttagcaggaacccccactttactacctaaatattttggtgaatttggaaaactaaga
ccctcaaaattatttgtacattgggatatcgaaccggccttagaaaaagctgattttgtc
atgactttacgtctacaaaaagaaagaatgagtcaacatttactgccaagtttacgggaa
tatcatcaactatttggaattacacgtgatcgcctaaaactttgtcaaccaggagtcaaa
atattacaccccggacctgttaaccgaggagtagaaattagctctgacttaatggacgac
ccacagttaagtctaatttctcaacaagtcaccagtggcattgctgtcagaatggcttta
ctatatcttttaggaggaggcaaagctgatcaataa

DBGET integrated database retrieval system