KEGG   Trichodesmium erythraeum: Tery_4493Help
Entry
Tery_4493         CDS       T00387                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ter  Trichodesmium erythraeum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tery_4493
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tery_4493
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tery_4493
Enzymes [BR:ter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tery_4493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_4493
CYORF: 
UniProt: 
Position
complement(6932847..6933644)
Genome map
AA seq 265 aa AA seqDB search
MISVSDCFESLRNNSSQCALIPFITAGDPDLETTAKALEVLDRSGANMIELGVPYSDPLA
DGPVIQAAATRSLNRGTTLESVLEVVQTVSPKLRSPIILFTYYNPILYRGVENFLKKIYD
VGARGLVVPDLPLEEADILLEPAKDIGIELTLLVAPTSPKERIKAIAHQSQGFIYLVSVT
GVTGMRAQMQTRVEDLLAQMREVTDKPIGVGFGISQPEQALQVKKWGSDAVIVGSAVVKR
LAEGSPDEGLKAIGEFCQNLKAAIN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagtctccgattgttttgaatctctacgcaataatagtagtcagtgtgctcta
attcccttcattaccgcaggggacccagacttagaaacgacagccaaagctctagaggta
ttggatagaagtggggccaacatgattgagttgggagtcccttattctgaccctttagct
gatggtccagtaattcaagccgctgccacccgttccttaaaccgagggactactttagag
tcagtattagaggtagtccagaccgttagtccgaaattgcgatcgccaattatcctattt
acttattacaacccaattttgtacagaggagtcgagaacttcctaaaaaaaatttatgat
gtaggagctagaggtttagtagtaccagacctgccattagaagaagccgatattttatta
gaaccagcaaaagatattggcatagagctaaccttattagtagcacccacaagtccaaaa
gagagaataaaggcgatcgctcatcagtcccaaggatttatatatttagtaagtgtaacc
ggagtaacaggaatgcgtgctcaaatgcagaccagagtagaagacttgctagcacaaatg
cgggaagttacagataaacccataggcgtcggctttggtatttctcaaccggaacaagcc
ttacaggtcaaaaagtggggaagcgatgcagtcattgttggtagtgcagtagtaaagcgg
ttagcagagggaagtcccgatgaaggtttaaaagcgatcggcgagttttgtcaaaatttg
aaagcagctattaactga

DBGET integrated database retrieval system