KEGG   Trichodesmium erythraeum: Tery_4608Help
Entry
Tery_4608         CDS       T00387                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ter  Trichodesmium erythraeum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tery_4608
Enzymes [BR:ter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tery_4608
Exosome [BR:ter04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tery_4608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4608
CYORF: 
UniProt: 
Position
complement(7085314..7086315)
Genome map
AA seq 333 aa AA seqDB search
MTEVNLSTESPVVRPRRLRRTPALRRMVEETQLTVNDLIYPLFVMEGEGQKVEVVSMPGS
YRYTLDLLLKEIEDAYNLGINAIALFPLVAEAKKDNFGTESYNSEGLIQRTVRAIKQTIP
DIVVITDVALDPYSSKGHDGIVGKNGVILNDPTVEVLVKQALSQAEAGADIVAPSDMMDG
RIGAIRKALDAAEYFDVGILAYSAKYASAYYGPFRDALDSAPKFGDKKTYQMDSANAREA
LKEVALDIAEGADMVMVKPALAYLDIICEVKKTTNLPVAAYNVSGEYAMIKAAGEKGWID
EKKVMLETLTSMKRAGADLILTYFAKEVALILK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagtaaatttgtccacagaatctcccgtcgtacgtccccgtcgtcttcgtcgc
actcctgctttgcgacgcatggttgaagaaacccagttgacagtcaacgatctaatttat
ccattgtttgtaatggaaggagaagggcaaaaagtcgaggttgtttccatgccaggcagt
tatcgctatactctagacctactgctcaaagaaatagaggatgcttataatttaggaatt
aatgcgatcgctttattccccctagttgcggaagctaaaaaagacaattttggcaccgaa
agctacaactcagagggtttaatacaaagaactgtaagggcgatcaaacaaacaatacca
gatattgttgtcattactgatgtagcccttgacccctattccagcaaaggtcatgacggt
attgtagggaaaaatggagtcattctcaacgaccctactgtagaagttttggttaaacaa
gcactatctcaggccgaagcaggtgccgatatcgtcgctccctcagatatgatggatggg
cgtattggagcaattcgcaaagctctggatgctgctgaatactttgatgtgggaatactt
gcctactctgctaaatatgcctcagcttattatggcccgtttcgggatgctttggactct
gcaccgaaatttggggacaaaaagacttatcaaatggactctgctaatgctagggaagcc
ctcaaagaggtggctttggatattgccgaaggtgcagatatggtaatggtcaagcctgcc
ctcgcttatttagatattatttgtgaggtaaaaaagacaacaaatctacctgtagctgct
tataacgttagtggggaatatgccatgattaaggctgctggtgagaagggttggatagat
gaaaaaaaggtgatgttggaaactttaaccagtatgaaacgggctggtgcggatttgatt
ttgacttattttgctaaggaagttgcattaattttgaaatag

DBGET integrated database retrieval system