KEGG   Trichodesmium erythraeum: Tery_4616Help
Entry
Tery_4616         CDS       T00387                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ter  Trichodesmium erythraeum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ter00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4616
CYORF: 
UniProt: 
Position
complement(7095389..7096027)
Genome map
AA seq 212 aa AA seqDB search
MNLPTVPDFVSPNDLKTKYQTSVTEAEMVQAVRTLLIGLGENPDREGLLDTPKRVVKALK
FLTSGYNQSLDELLNGAVFSEDTSEMVLVRDIDLFSSCEHHILPIIGRAHVAYIPNGKVI
GLSKIARICEMYARRLQVQERLTAQIADALQGLLRPLGVAVVVEATHMCMVMRGVQKTGS
WTTTSAMRGVFADDVKTRQEFMSLIKHSHNFH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaccaacagttccagattttgtttctcccaatgacttgaaaacgaaatatcag
acttcggttacagaagctgaaatggtgcaagcggtaagaactttattaataggactagga
gaaaacccagatcgagaagggttattagatactcctaaacgagtggtaaaagcactaaaa
tttctcacttcaggttataatcaatctctagatgaactgctcaatggagctgtttttagt
gaagatacctcagagatggttttagttcgagatatcgatctttttagctcttgcgagcat
catattctccctattattggtcgcgctcatgtagcatatattcccaatggaaaagttatt
gggctatcaaaaattgctcgaatttgtgaaatgtatgcccgacgtttacaagttcaagag
cgtctaacagcacaaatagctgatgcacttcaagggttacttagacctttaggtgttgct
gtagttgttgaagcaactcatatgtgtatggtcatgcgtggagtacaaaaaactggttct
tggacaactactagcgctatgcgtggtgtttttgctgatgacgtgaaaactcgtcaagaa
tttatgagtttaattaaacatagtcataatttccattag

DBGET integrated database retrieval system