KEGG   Trichodesmium erythraeum: Tery_4936Help
Entry
Tery_4936         CDS       T00387                                 

Definition
protein-arginine deiminase (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ter  Trichodesmium erythraeum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
Tery_4936
CYORF: 
UniProt: 
Position
complement(7515207..7517489)
Genome map
AA seq 760 aa AA seqDB search
MGWIQYIKIALVNTVGALVGIIWVPVPQAVAQSSLPEPANSEISALETIKSINKNLKIPK
TISSLTELYQIKDQLKVELERVSKMPNFKKVREPWQYQFQLQQYEKTLKDFRSIEAKIIK
EEKALQSWKQALSIATNAVAKGKKLQANYQTWEEAENLWLEAIYSLRQIPQDSLMTDKAI
EKMLEYQGYLAVACYEKVMAVRVWEKEKEKKTNSHTKTYRPIAYSLSPGFTMYGDTNRDG
KVDETDKSGRENWSLSEGALMLFNNDDDNGDLIPDWRDGDVNGENDVADLAIVNIRLAEN
YRDAQIYISTDADVNNYINIFQKTESGWQPVDLSGTEALISRAKIVLGVEAKQFADRDWK
GVVNLTAIAKKNGRQIASDSIQIGVVPWLMSPNTAPVKELHVSERGLANQKFISKITEII
EKTGVTAKINPGGTTWMQDTKKIGYVQFPTQGKMHNMNVVLKGNRLQENDQYARSLLKEN
FGWFEVGKPRQLDPLNRWADAYGNLEVTPPLPGYPMGRVYYGKAGEVGMNPDIIDFIKAQ
KIQGPPVDIDTSWLMMRHVDEIISFIPSKTGKPLMLIVSPEAGVKLLEELSEENYGKAAI
NRGLSTQITVRAALKNEKLVQHNLYLQREKLNPLIEKLKQEFNLSNDQIIQVPAMFGYSG
YAWWPNMVNSVVINGELLVSSPGGALINGRDYTQEKFRRLVSNSSLNINFMDDQYYQQLR
GNVHDAVNTTRLGKNHPFWKSLSENILGFRGQSLDMVDTK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgggttggatacaatacataaaaatagctctagtaaatactgttggggcattagtagga
attatctgggtacctgtacctcaagcagtggcacaatcttcacttcctgagccagctaac
tcagaaatttctgccttagaaactatcaagtcgataaacaagaacttaaaaattcctaaa
acaataagttcactgacagaactgtaccagataaaagatcaattaaaagtagaactagag
cgagtctctaaaatgccaaacttcaagaaagttagggaaccttggcaataccaattccag
ttacaacagtatgaaaaaactttgaaagacttccgcagtatagaagcaaaaattattaaa
gaagaaaaagctcttcaaagttggaaacaagcactgagcatagcaaccaatgctgtagca
aaaggaaaaaaactacaagcaaattatcaaacctgggaagaagcagaaaatctttggtta
gaggcaatttatagtttacgtcaaattcctcaagattcattgatgacagataaagcgatc
gaaaaaatgcttgaatatcaggggtatctagcagtggcctgttatgaaaaagtaatggca
gtaagagtatgggaaaaagagaaagaaaagaagacaaatagccataccaaaacttatcga
cccattgcatatagtttatctccaggttttaccatgtatggtgatactaacagagatggg
aaagtggatgaaactgacaagtcaggtagagaaaactggtctttatcagaaggtgcatta
atgttatttaataatgatgatgataacggcgatctaatcccagattggcgagatggggat
gttaatggtgaaaatgatgtagcagatttagctattgtcaatattcgattagcagaaaac
tatagagatgctcaaatctacatctctactgacgcagatgttaataactatatcaatatc
ttccaaaaaacagaatctggatggcaaccagtagatctttctggcactgaagcattaata
tctagagcaaagatagtattaggtgtagaagctaaacaatttgctgacagggactggaaa
ggagttgttaacttgacagcgatagctaaaaaaaatggtagacaaattgcttctgatagt
attcaaataggtgtagttccttggttaatgtctcctaatactgctccagtcaaagaactg
cacgttagtgagcgaggtttagctaatcaaaagtttatcagtaaaatcactgaaattatt
gaaaaaacaggtgtgacagctaaaattaatcctggcggaacaacctggatgcaagatact
aaaaaaataggttatgtgcagtttcccactcaaggtaaaatgcacaatatgaatgtggta
cttaaaggtaaccgtctacaggaaaatgatcagtatgctagaagcctcctcaaagaaaat
tttggttggtttgaagttggtaaacccagacaactagatcctctcaacaggtgggcagat
gcttatggaaatctagaagtaacaccacctttaccaggatatcctatgggaagagtttat
tatgggaaagcaggtgaagtgggtatgaatcctgatattattgatttcatcaaagcacag
aaaattcagggtcccccagtagatattgatacttcttggttaatgatgcgtcatgtagat
gaaattattagttttattcctagtaaaactggcaaacctctaatgttaattgtgagtcca
gaagcaggggtcaaattattagaagaactcagtgaagaaaactatggtaaagctgctata
aatcgtggtttaagcactcaaataacagtgcgggctgcgttgaaaaatgaaaagttagtt
cagcataatctctatttacaacgggaaaaattaaacccattaattgagaagttaaaacag
gaatttaatctgagcaatgaccagataattcaagtaccagctatgtttggatatagcggt
tatgcttggtggccgaatatggttaattcagtggtaattaatggagaattattggtttct
agtcccggaggagcattaattaatggtcgagattatactcaagagaaatttcgcaggttg
gtgtcgaattcaagcttaaatattaattttatggatgatcaatattatcaacaactaaga
ggaaatgtacatgatgctgtgaatacaactcgcttaggaaaaaatcatcctttctggaaa
tccttatctgaaaatatattagggtttagagggcaaagtttagatatggtagatacgaaa
taa

DBGET integrated database retrieval system