KEGG   Trichodesmium erythraeum: Tery_4967Help
Entry
Tery_4967         CDS       T00387                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00860  Porphyrin and chlorophyll metabolism
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tery_4967
Enzymes [BR:ter01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Tery_4967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 MCM Sigma54_activat CAP_N VWA_3 PRCC CCDC53 AAA_2 Nterm_IS4
Motif
Other DBs
NCBI-ProteinID: ABG53881
JGI: Tery4967
CyanoBase: Tery_4967
CYORF: Tery_4967
UniProt: Q10V43
Position
7577442..7579460
Genome map
AA seq 672 aa AA seqDB search
MPVVNPSTIINFPLAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHSLL
PPIEIVKGSISNCNPNYPEEWDEQVLQESPNATGEEISTEVIPAPFIQIPLGVTEDRLLG
SVDVEKSVKQGETVFQPGLLAAAHRGVLYVDEINLLDDNIANLLLTVLTEGKNQIEREGI
SFQHPCQPLFIATYNPEEGPLREHLLDRIAIALSADMVLGLDQRVEAVGQALDYANSPQA
FLERYTEDIDNLKTQILLAREWVKEVVITHEQILYLVEEAVRGGVQGHRAELFAVRVAKA
SAALDGRTTVNADDLRRAVELVIVPRATIVPTPPEEEQQPPPPPPPPPEDQSEQEQDEQE
DEEKPEPPEEEEASIPEEFLFDPEGVVLDDSVLYFAQMANRQGKSGSRSIIFSEDRGRYV
KPMLPKGKVRRIAVDATLRAAAPYQKSRRERQPNRRVIVEQGDMRAKRLARKAGALVVFV
VDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVSLIPFRGEQAEVLLPPTRSITSARRRL
EKMPCGGGSPLAHGLTQAVRVGVNAKQSGDVGQVVIVAITDGRGNIPLARSLGEPMLDAE
KPNIKEELLEIAGKIRGLGIQLLMIDTENKFVSTGFAKELAKQSGGKYYHLPKASDQAIA
AMTQNALKDAIG
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgttaacccttccactatcatcaactttcccctagctgccgtagttggacaa
gaagcaataaaactggccttattattagctgcggtagatccaggattgggaggagtggcc
attgctggtcgtcgaggtacagcgaaatctgtaatggccagagctatacattcccttttg
cctcctattgaaattgtcaaaggttctattagtaattgtaatcccaactatcctgaagaa
tgggatgagcaagttttacaagagagtcccaacgctacaggagaagaaatatctacagaa
gttatacctgcaccttttattcaaattcctctgggagtgacagaagacaggttattgggt
tcagtggatgtggaaaaatcagtcaaacagggggaaactgtatttcaaccagggttatta
gctgctgctcaccgaggggtattatatgtagatgaaattaatctccttgatgataatatt
gctaatttattactgacggttttaacagaaggcaaaaatcaaatagagcgagaaggtatt
agttttcaacatccctgtcaacctctatttattgctacttataatccagaagaaggacct
ttaagagaacatttgcttgatagaatagcgatcgctctctcagcagatatggtcttaggt
ttagaccaacgagtggaagcagtaggacaagctttagattatgctaattctccccaagct
tttctggaacgatacacggaagatatagataatctcaaaactcaaattctgttagcaagg
gaatgggtaaaagaggtagtgatcacccatgaacaaatactctatttagtagaagaagca
gttcgaggaggagtacaaggacatcgggcagaactttttgctgtgcgagttgctaaggca
tcggcggcgttggacggacgaacaactgttaatgctgatgacttacgccgagcagtggag
ttagttattgtgccacgagcaacaatagtgccaactccgccggaagaagaacaacaacca
ccaccgccaccgcctcctcctccagaagaccagtccgaacaggaacaagatgaacaggaa
gatgaggaaaaacctgaacctccagaggaagaagaggcaagtattccggaagagtttttg
tttgatcctgagggagtggtattggatgatagtgttttgtattttgctcaaatggcaaac
cgtcagggtaagtcgggtagtaggagtataattttttctgaagatcgggggcgttatgtg
aaaccaatgttgcctaaaggtaaggtgcgacgtattgctgtggatgcaactttacgggcg
gctgctccttatcaaaagtctagaagggaacgtcaaccaaaccgcagggttattgtggag
cagggtgatatgcgggcaaaacggttggcaagaaaggcgggtgctttggtggtttttgtg
gttgatgcttcgggttcgatggcgttgaatagaatgcagtcggcaaagggtgcggtgatg
cagttgttgacggaggcgtatcagagtcgtgatcaggtttcgttaattccgtttcggggg
gaacaggcggaggttttgttaccgccgactcgctcgatcacttctgcccgaagacgtttg
gaaaaaatgccttgtggtgggggttcgcctttggcacatggtttgactcaggcggtgaga
gtgggtgtgaatgccaagcagtctggtgatgtggggcaggtggttattgtggctattact
gatgggcgggggaatattccgttggcgcgttctttgggtgaaccgatgttggatgctgaa
aagccgaatattaaggaggagttattggaaattgctggtaaaattcggggtttgggaatt
cagttgttgatgatagatacggagaataagtttgtttctactgggtttgcgaaggagttg
gcgaagcagtcggggggtaagtattatcatttaccgaaggcgagtgatcaggctattgct
gctatgactcagaatgctctgaaggatgctattgggtaa

DBGET integrated database retrieval system