KEGG   Tetrahymena thermophila: TTHERM_00039050Help
Entry
TTHERM_00039050   CDS       T01020                                 

Definition
oxidoreductase, short chain dehydrogenase/reductase family protein (EC:1.1.1.30)
Orthology
K11166  
dehydrogenase/reductase SDR family member 7B [EC:1.1.-.-]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 305 aa AA seqDB search
MGILAVALVLIVIKKLYNWIQIKLVKPNFEGKTVWITGASSGIGEQLAKDFSRLGASLII
SSRKIQDLEKVKSQCKDPSKVTVLPLDMSKTKEVIKQTEDFIKDLEKQNKKLDIVIENAG
VSMRSEFKDYSYENHEYMTNLNYNGPVAHVKGLLDHFIRNKSGHIVLINSIAGLLSPGMR
TSYVGSKHALRGFFDSLRAEVSEFNIKVSSIYPGYVQTNVSANALSGEAGQSFGKTDGNI
QEGETIEKFAEQAMLAIYKQKNDAVITKSIKHELGVYMRNVSFDLVHWLTRKNVQQQKDA
LKKAV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggaatattagctgttgctttagttttgattgtgatcaaaaaattgtacaattggatt
caaattaagctagtcaagccaaactttgaaggcaagactgtctggatcactggcgcgtca
tcaggtataggagaataacttgcaaaagatttttccagattaggagcttcattgatcatt
tcttctagaaagatttaagatttagaaaaagtaaagagctaatgcaaagatccttctaag
gtcactgttttacctttagatatgagtaaaactaaagaggttataaagtaaactgaagat
ttcattaaggatcttgaaaagcaaaataaaaaacttgatattgttatcgaaaatgcagga
gtttctatgagatctgaatttaaggattattcatacgaaaatcacgaatacatgactaat
ctaaattacaatggacctgtagctcatgtcaagggtttgttggatcattttataagaaac
aaatctggtcatatcgtcttgattaacagtattgctggtctcctttctccaggcatgaga
accagttatgtaggatccaagcatgcattaagaggtttcttcgattctcttagagctgag
gtttctgaatttaacattaaagttagctcaatttatccagggtatgtctaaaccaacgta
agtgcaaatgctctttcaggagaagctggataatcatttggtaagactgatggtaacatt
taagaaggagaaacaattgaaaagtttgctgaacaagctatgttggcaatttacaaacaa
aagaacgatgctgttatcacaaagtcaatcaagcatgaacttggtgtttacatgcgtaac
gtctcttttgatttagttcactggttaactcgcaaaaatgtttaataacaaaaagatgct
ctcaagaaagcagtttga

DBGET integrated database retrieval system