KEGG   Tetrahymena thermophila: TTHERM_00043770Help
Entry
TTHERM_00043770   CDS       T01020                                 

Definition
alpha-galactosidase, putative (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tet  Tetrahymena thermophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TTHERM_00043770
  Lipid metabolism
   00561 Glycerolipid metabolism
    TTHERM_00043770
   00600 Sphingolipid metabolism
    TTHERM_00043770
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    TTHERM_00043770
Enzymes [BR:tet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TTHERM_00043770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 381 aa AA seqDB search
MRKLIAILLIACAISSVSCLDNGLAKTPAMGWNSWNHFACNINEDLIKATADQIVNSGLA
ALGYNYINLDDCWQISRDADGYIVEDKEKFPSGIKALADYVHSKGLKFGLYSDAGEFTCQ
KRPGSLGYEVKDAQRYAEWEVDYLKYDNCFNKNINPKIRYPPMRDALNATGRPIYFSMCE
WGQYNPATWAPEVGNSWRTTGDIKDRYSSFLSILEKQVGLEKYAHPGAWNDPDMLEVGNG
GMTTHEYEAHFALWALLKAPLLIGCDVSKMSEDTIRILTNKEIIAINQDPLGIQGHRVKK
SGFWFWSWQLWMGQLEDGVAIILFNTSAWERNLSFTFKEVGIVGPATIRDLYQHEDLGVF
SNSFSAIVPKHGVVVVKVVPV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattaattgctattttgctaattgcttgtgctattagctccgttagctgctta
gataacggtcttgctaaaactcctgctatgggctggaactcttggaaccattttgcatgt
aacattaacgaagatttaattaaagcaactgctgattaaattgtcaactctggcctcgct
gctcttggttataattacattaaccttgatgactgttggtaaatttctagagatgctgat
ggttacattgttgaagataaggaaaagttcccctctggtataaaggccttggctgactat
gttcatagtaaaggtttaaagtttggtctttacagtgatgctggtgaatttacttgctaa
aagagaccaggttctttaggttatgaagtcaaggatgcttaaagatatgctgaatgggaa
gttgactaccttaaatatgacaactgcttcaataaaaatattaacccaaaaattagatat
cctcccatgagagatgctcttaatgccactggtcgtcccatctatttctctatgtgtgaa
tggggttaatacaatcctgccacctgggctcctgaagttggtaactcttggagaactact
ggagatattaaagatcgctattcttcattcttatctatccttgaaaaataggttggatta
gaaaaatatgctcatcctggtgcttggaatgatcctgatatgttagaagttggtaacggt
ggtatgactactcatgaatacgaagctcattttgctctttgggcccttttgaaggctcct
cttttgattggttgtgatgttagcaaaatgtcagaagacactattagaattcttacaaac
aaagaaataattgctattaatcaagatcctttgggtatctaaggccacagagttaaaaaa
tctggattttggttctggagctggtaactttggatgggttaacttgaagatggtgttgct
atcattcttttcaatacctctgcttgggaaagaaacttgtctttcacattcaaagaagtt
ggaatagtaggacctgctaccatcagagatctatactaacacgaagacttgggtgtcttt
agcaattctttctctgctatagttcctaagcacggagttgttgtagttaaagtagtacct
gtctga

DBGET integrated database retrieval system