KEGG   Tetrahymena thermophila: TTHERM_00046530Help
Entry
TTHERM_00046530   CDS       T01020                                 

Definition
cyclic nucleotide-binding domain containing protein (EC:2.7.11.14)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 808 aa AA seqDB search
MNFLNKSKNGAASGNDDENPHKDSEVENVGDKKKLPVTAEGETIYENIAPVPKKKTPNDN
TFIITCLKNHFVFYNLNEAELQINFIFFYQKAQRVELTIKMFYCEVPMNDFIFKQSDNAT
SFFILERGAMEVIVNEKSKRELKAGDGFGELALLYNAPRSASVKALDHCYLWGIDRNTFR
RAVEEMITKEYEENRKFMEVVRFFHNLTNEQKDAIAAVLIVQKFYKNQVIVTEGDPASSF
YIIKEGNVTVWKGNKEVRKLYKGDSFGEQALYYNTVRQMTVRAEDEVKCLALGRDTLTKV
LGDQVHAVTFRNLQKWAFEKNNYLQKLNKAQIDKVLDVMKISSYKAGDIIMKKGTVANQK
IVVIIEGSLKKAKSGMTVASKAQAWGEEYMLDQNKNKTFDDDIVMETDGVIAEITSENFV
ECIGGQLEEIISNNQKNQEKKMMKADQAKRKELQNIRMSELIYIKTLGNQLTNLKQNINI
NQQFKKTAFGQFGPVYLVKANYDKNLYALKSFNKVQISEQSLEKYICQEKVVLEIVNFPF
IIQYARSFKDSFDVYFLVEYVKGIELFDVIRDIGLLNTYDSQFYVASMILILEYLHHQNV
IYRDMKPENIMVDENGYLKLIDLGTAKFLKGRHGLGNRTFTIIGTPHYMAPEIICGKGYN
CYVDLWSVGICLYEFMCGMVPFGEEAEDPYEIYEDIIKKEINYPSYLKDKKAKKLMDQLL
SRVPEVRLGGSYQTLKSNPWFENFDWDKLLDKELKGPYIPPSEKLLSDKDIKEFEEHKKL
IIDEIQQEQNVRAIEKDNNNETKWDENF
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcttaaataaatctaagaacggagctgctagcggtaacgatgatgaaaatcct
cacaaggattcagaggttgaaaatgtgggtgataaaaaaaaactacctgttacagcagaa
ggagaaactatctatgaaaatattgcacctgtccctaaaaagaaaacaccaaacgataac
acatttattattacatgcttaaagaatcacttcgtcttctataatttaaatgaagctgaa
ttgtaaataaattttatttttttttactaaaaagcctaaagagtagaattaactataaaa
atgttctactgtgaagttcctatgaatgatttcatattcaaataaagcgacaatgcaaca
agcttttttatattggaaagaggtgcaatggaagttatagtaaatgaaaaatcaaagaga
gaattaaaagctggtgatggttttggtgagttagctctactttataatgctcctcgttct
gcatctgttaaggctttagatcattgctatttgtggggaattgatagaaatacattccgt
agagcagttgaagaaatgattactaaagaatatgaagaaaatcgtaaattcatggaagta
gtccgttttttccacaatctaactaatgaacaaaaagatgctatagctgcagttcttatt
gtgtaaaaattctataaaaactaagtaattgtcactgaaggtgatcctgcttcttctttc
tacattattaaagaaggtaatgtcacagtatggaaaggaaataaggaagtaaggaagctt
tacaaaggtgactcatttggtgaataagctctttattataatacagtcagataaatgaca
gttagagctgaagatgaagtaaaatgtcttgccttaggtagagatactctaacaaaagtt
ttaggtgatcaagtacacgccgttacttttagaaatcttcaaaaatgggcatttgaaaag
aacaattatctttaaaagcttaacaaggcttaaatagacaaggtcttagatgttatgaaa
atttcatcttacaaagcaggtgatattatcatgaagaaaggtactgtcgccaatcaaaaa
atagtagttattattgaaggttctcttaagaaagcaaagagcggtatgactgtcgcatcc
aaagctcaagcctggggtgaagaatatatgcttgattaaaataaaaataaaacttttgat
gatgatatcgttatggaaacagatggtgtcatagcagaaataacatctgaaaactttgta
gagtgtattggcggttaattggaagaaattatctctaacaactaaaaaaattaagaaaaa
aaaatgatgaaagcagatcaggccaagagaaaggaactttaaaacatcagaatgtctgaa
ttaatttacatcaaaactcttggtaactaactaactaacttaaaataaaatattaatatt
aattaataatttaaaaaaacagcttttgggtagtttggtcctgtttatttagttaaagca
aactatgataagaatttatatgccttgaagagtttcaataaagttcaaatatcagagcaa
agtttagaaaaatacatatgccaagaaaaagttgtacttgaaattgttaacttcccattt
attatttaatacgccagatcattcaaggattcatttgacgtttatttcttagttgaatat
gttaagggtattgagttgtttgatgttataagagatattggtttattaaatacatatgat
tcttaattttatgttgcttctatgattcttatccttgaatatctccaccactaaaacgtt
atttatagagatatgaaacctgaaaacatcatggttgatgaaaatggttacttgaaatta
attgatttgggtactgctaaattcttaaaaggaagacatggtcttggtaatagaacattc
acaattataggtactcctcattacatggctcctgaaattatttgtggtaaaggttataac
tgctacgtcgatctctggtcagttggtatttgcctttatgaatttatgtgcggtatggta
ccttttggtgaagaagctgaagatccatatgagatttatgaagatattattaagaaagaa
atcaactacccaagctacttaaaggataaaaaggctaagaagttgatggatcaattgcta
agtagagttcctgaagtaagattaggtggttcttatcaaactcttaaatctaatccttgg
ttcgaaaacttcgattgggataaactacttgataaggaattaaagggtccttatattcca
ccttcagaaaaattgcttagcgacaaagatattaaagaattcgaagagcacaagaaatta
ataatagatgaaatacaataagaataaaatgttagagctatcgaaaaagacaataataac
gaaactaagtgggatgaaaatttctga

DBGET integrated database retrieval system