KEGG   Tetrahymena thermophila: TTHERM_00046760Help
Entry
TTHERM_00046760   CDS       T01020                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 478 aa AA seqDB search
MSDKKNQKIDLSQFEGPDGMQKLMKLAMEFQENEKQQKGQKKNKKKVDQDLGEDGDANSQ
AENDDDGDDDEEEEIKAREGCSLAYDALNIKFVQEENDLNPLFKKNMLFKPNYVHQIYGQ
EEEIEGYEDLQINIYMLSGSLHTLVEYSYGKKMKQHEDFLQKLRDNCFVSDFCLKRKEFN
QHMAKEKSFKPIGDKFKEITAKNGEKFEIYYCNTQKHPEFSEYKKRMQVFAKFFIEVGSY
IEDNEYWHHFLIFHVDQNGMYTFAGFTNKYEYMFNINKSRHQISQIVILPIFQRLGLATE
LLNCHYKTAQEDSKCLELTVEDPSPEFQIVRDIIETKLVIDGKFWQWFEAIRPKTIRGIL
QLEGIQISHQQEITQATKIPKYQIQRIFEILMLSKLDQSNKQVMDRYRGHFIKYRKDVNE
VRTQRKVPYIIFDNKAVKIDVQAIIEQKKQLEPNDAFYLEEYEQTLEQYNNVIQKLKI
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataagaaaaaccaaaaaattgacctctcttagtttgagggtccagatggaatg
caaaagctaatgaaattagctatggagttccaagaaaatgaaaaataacaaaaaggataa
aaaaagaataaaaaaaaagtagattaagacttaggagaagacggagatgctaattcataa
gcagaaaatgacgatgatggtgatgatgatgaagaggaagaaattaaggcaagggaaggc
tgtagtttagcatatgatgctttgaatattaaatttgtataagaagagaatgatttgaac
cctttatttaaaaagaatatgctctttaagccaaattatgttcatcaaatttatggttaa
gaagaagaaatagaaggttatgaagacctacaaattaatatttatatgctttcaggctct
ctccatacattagttgaatactcttatggaaaaaagatgaaatagcatgaagatttttta
tagaagcttcgtgataattgttttgtgagtgatttttgtctcaagcgcaaagaattcaat
tagcatatggccaaagagaagtcatttaaaccaattggagataaattcaaagaaataact
gcaaaaaatggagaaaaatttgaaatatattattgtaatacttaaaaacacccagaattc
tctgaatataaaaagcgcatgcaagtatttgctaaattctttatcgaagtaggctcctac
attgaagataatgaatattggcatcacttccttattttccatgttgattagaatggaatg
tacacttttgcaggatttacaaataaatatgaatacatgtttaacatcaataaatcaaga
cattaaatttcttagattgtaattcttcctatcttctaaagattaggccttgctacagag
cttttgaattgtcactataaaactgcctaagaagatagtaagtgtttagaattaacagta
gaggatccctcacctgaattccaaatcgttagagatattattgaaactaaattagtcatt
gatggaaagttttggcaatggtttgaagctattcgcccaaaaacaataagaggcattctt
tagcttgaaggaatataaattagtcactaataagaaattacccaagctactaaaattcct
aaatattaaatataaagaatttttgaaattcttatgcttagcaaattagattaatcaaat
aagtaggttatggacagatatagaggacattttatcaaatatagaaaagatgttaatgaa
gtcagaactcaaagaaaagttccttatataatttttgataataaggctgttaaaattgat
gtataagctatcattgaataaaaaaaacaattggagcctaatgatgccttttatttagaa
gaatatgaacaaacactagaacaatataataatgtaatttaaaaactcaagatttga

DBGET integrated database retrieval system