KEGG   Tetrahymena thermophila: TTHERM_00047700Help
Entry
TTHERM_00047700   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TTHERM_00047700
Peptidases [BR:tet01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TTHERM_00047700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 1271 aa AA seqDB search
MITSFLQYISLNQKERDESIKKFSKLMIQKFKQRRYTHRLSTSLLIIEIHIQTSAVSIYN
DFILQKRGIEEGVSAAAPHQHQSSENSMEQEEHKDNIVLDQGAAAAGVIIEANNSGDMEE
ENHILEEGEQADTENQIINEELNLEEKTQEQEAVKEQLVNQALKFKELWEKFNQDFESSP
SSTYFVLSSHWLRYWKKHVSYDRVIKGKEPIYEHFAKHGDKLENANKDLIQTTVDQSSDQ
YYEFSELNEDGSTIILKPQLQEIQDYAIVDKDIVNLLSENYLNFQVIPRRAFKRPDGKKG
IEIYYRKIAGKCLGINSFITYFCKKKNLQCLQQDIKLHLVLFQELENKINYYQIISNNSY
MDVNLIILNHSLLKDIDGGRAKSFTCKQIQLFSKENQEELKHFLVPIIKRHQYNQAYGYQ
NQPQNINLQTIRLWKLKENDTIEKVFQQLFEATRRFTSFEYKLKSPIVFIERNNNNTVEE
LNIEEDSTIFVEVQRQNGWTLKLEGEPDEDQCEFCRNYKVLKFECKCQKVKYCSDSCKFK
DQEYHARVCDKAGEDSEDEQEQPYKFENDSVRGLCGLQNLGNTCFMNSALQCMSNTIPLT
IYFLKKIYLQEINEQNVLGTQGKLAKQYAKFIKNLWTGNQRTFSPIALKMAVARLQSMFS
GYQQHDSQEFLSYILDGLHEDLNRVKVKKYTESIDSNGRPDQVVAKESWLNHLKRNQSII
VDLMQGQFKSKVTCPDCSKESITFDPFLTCSLPIPNKEIKVISMYLIFANNRKTAIEVKY
TYEPDQSKQQTIKDLKEYIQKTYQTSSNLILYSLTFDRVKDQFDDETPLENVRKTFKEPQ
KNALMIEYDVDIHDENKMKVFFTFTRLKEEMYMARRLVKSNFTFIRPFIIEKKANKKDVH
LALFEYLKPIFLRNSKPDSEFAIDAEKLKLDELYEKYILNVENPPYRLLVETDAQDYIER
PCTWCNQQKCKNCPVQYNDDEDPMEDFSKRSKSHYHSFRFECFVDQTTDFGRMINSLHSL
DHSSQNNDSNTSASHNLDAKTNIYDCLKLFEQPERLGEDNEWYCPECKKHQKAQKQIVIY
RAPDILILHLKRFKGSSGLFKSKLTKVVDFPIQGLDMTDFVIEKETPQSYYEQDADYFKD
IHINPQKVEQNHIDESFKQSQPTQDEIDQENNKNHETNHSPSNNEEINIEEEQKNNDSKM
EQEGDNKNDKRLFYDLYAITNHYGSLGFGHYTAYAQNNNRWFCFDDSCVRDVTPDQLVSE
ASYILFYKRRK
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atgattaccagctttttataatatatttctctaaattaaaaagaaagagatgaaagtatt
aaaaaattttcaaaactcatgatttagaaatttaaatagcgtagatatacccatcgcctt
tcaacttctttattgattatagaaattcatatttaaactagcgctgtgtcaatttataat
gattttattttgtaaaaaaggggcatagaagaaggagtttcagcagctgctcctcattag
caccaaagcagtgagaattctatggaataagaagaacataaggataatatcgttttagat
tagggagctgcagcagctggagttattatagaagctaacaatagcggagatatggaagaa
gaaaaccatattttagaagaaggtgaataagcagacactgaaaactaaattataaatgaa
gaattgaatttagaagaaaaaacctaagaataggaagctgtcaaagaacaattagtaaac
taagcgttgaaatttaaagagttatgggaaaaattcaattaagattttgagtcctctcct
agcagcacttacttcgttctctcatctcattggctcagatattggaagaaacacgttagc
tacgatagagtaattaagggtaaagaacctatttatgaacatttcgcaaagcatggagac
aaattagaaaatgctaataaagatctcatttaaacaacagttgattaaagtagtgattaa
tattatgagttttcagagcttaatgaagatggctctactataattttgaagccttagttg
taagaaatttaagattacgctatagttgataaagatatagtcaatcttttgtcagaaaac
tacttaaatttttaagttattcctagaagagctttcaagcgtcctgatggaaaaaaaggc
atcgaaatatactatagaaagatagctggtaagtgtttaggaattaactcattcataact
tacttttgcaagaaaaaaaatttatagtgtctataacaagatattaaacttcatttagtt
ttattttaagaattagaaaataaaataaattattatcaaataattagcaataattcttac
atggatgtcaatttaattatcttgaaccatagtttgttgaaggacatagatggaggaaga
gctaaatcattcacatgcaaataaatttaattgttttcaaaagaaaactaagaagagctt
aagcatttcctagttccaattattaaaagacactaatacaattaagcctatggataccaa
aattaaccttaaaatattaatttgcaaacaatcagactttggaagctcaaagaaaatgac
actattgaaaaggtattctagcaattatttgaagcaacaagaagatttacaagctttgag
tataaattgaaatctcctatcgtttttattgaaagaaataacaacaacactgtagaagaa
cttaacatagaagaggattctaccatttttgtagaagtttaacgttaaaatggatggaca
cttaaattagaaggtgagcctgatgaagactagtgtgagttctgtagaaactataaagtt
ctaaagtttgaatgcaaatgtcagaaggttaagtattgctctgatagttgtaaatttaaa
gatcaagagtaccacgctagagtctgtgataaggctggagaagattcagaagatgaataa
gaataaccttacaaatttgaaaacgattctgttcgtggattatgcggcttatagaatctt
ggtaatacatgttttatgaatagtgcactttagtgtatgagcaatacaatccctttgact
atttactttttaaagaagatttacttacaagaaattaatgagtaaaatgtacttggaact
caaggtaaattggctaagtaatatgcaaagtttattaaaaatttgtggacaggtaattaa
agaactttcagtcctatagctttaaagatggcagttgctagactctaatctatgttttct
ggttattagcagcatgattcctaagaatttttatcttacattttggacggtttgcatgaa
gatttaaatagagtaaaagtgaaaaaatacactgaatctatcgattcgaatggaagacct
gatcaagttgtagctaaggaatcctggttgaatcatttaaaaagaaactaaagtattatt
gttgacttaatgcaaggttaattcaagtcaaaagttacttgccctgattgctctaaggaa
tctataacctttgatcctttcttaacttgctctttacctattcctaataaggaaataaaa
gtaattagcatgtatttgatatttgcaaataacaggaaaacagcaattgaagttaaatac
acctacgaacctgaccaatcaaaataataaacaattaaagatctgaaagagtacatttaa
aagacatactaaacttcttcaaacttaattttatactctctaacatttgacagagttaaa
gatcagtttgatgacgaaactccattagaaaatgtaagaaaaacttttaaagaaccttaa
aagaatgctttgatgattgaatacgatgtggatatccatgatgaaaataaaatgaaggta
tttttcacttttactaggctgaaagaggaaatgtatatggcaagaagactagtaaagagc
aatttcacatttattagaccatttatcatagaaaagaaagcaaacaagaaagatgtccac
ttagctcttttcgaatatttaaaacctattttcctcagaaattcaaaaccagattcagag
tttgcaattgatgctgaaaaattaaaattagatgagctttatgaaaagtacatcttaaat
gtagaaaaccctccttacagacttttagttgaaactgatgctcaagattatattgagaga
ccttgcacctggtgtaactaataaaaatgtaagaactgtcctgttcaatacaatgatgat
gaagatcctatggaagatttctcaaaaagatcaaaatctcattatcactcttttagattt
gagtgcttcgttgattaaaccacggattttggcagaatgataaactctttacactcactt
gatcacagtagttaaaataatgactccaatactagtgctagccataatttagatgctaaa
actaacatttatgattgtttaaagctatttgagcaaccagaaagattaggagaagataat
gaatggtattgtcctgaatgcaaaaagcattagaaggcataaaagtaaattgttatttat
agagctcctgatatacttatccttcaccttaagagatttaaaggatctagtggtttattt
aagagtaaattaacaaaagtagttgatttccctatccaaggccttgatatgaccgatttt
gtgatagaaaaagaaactccatagtcatattatgaataggatgcagattattttaaagat
attcacataaatcctcaaaaagtagaataaaatcacatagatgaaagttttaagtagtca
taacctacacaagatgaaattgattaagaaaataacaaaaatcatgaaactaatcactca
ccttcaaacaacgaagaaataaacattgaagaagaataaaaaaataatgatagtaaaatg
gaataggagggtgataataaaaatgataagagattgttttatgatctctacgctattact
aaccattatggtagtttaggatttggtcactacactgcatatgcataaaataataataga
tggttctgctttgatgactcctgtgtcagggatgttactcctgattaacttgtgagcgaa
gcttcctacattcttttctacaaaagaagaaaatga

DBGET integrated database retrieval system