KEGG   Tetrahymena thermophila: TTHERM_00047700Help
Entry
TTHERM_00047700   CDS       T01020                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TTHERM_00047700
Peptidases [BR:tet01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TTHERM_00047700
Ubiquitin system [BR:tet04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    TTHERM_00047700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 1157 aa AA seqDB search
MSHQENFQGIEEGVSAAAPHQHQSSENSMEQEEHKDNIVLDQGAAAAGVIIEANNSGDME
EENHILEEGEQADTENQIINEELNLEEKTQEQEAVKEQLVNQALKFKELWEKFNQDFESS
PSSTYFVLSSHWLRYWKKHVSYDRVIKGKEPIYEHFAKHGDKLENANKDLIQTTVDQSSD
QYYEFSELNEDGSTIILKPQLQEIQDYAIVDKDIVNLLSENYLNFQVIPRRAFKRPDGKK
GIEIYYRKVNLIILNHSLLKDIDGGRAKSFTCKQIQLFSKENQEELKHFLVPIIKRHQYN
QAYGYQNQPQNINLQTIRLWKLKENDTIEKVFQQLFEATRRFTSFEYKLKSPIVFIERNN
NNTVEELNIEEDSTIFVEVQRQNGWTLKLEGEPDEDQCEFCRNYKVLKFECKCQKVKYCS
DSCKFKDQEYHARVCDKAGEDSEDEQEQPYKFENDSVRGLCGLQNLGNTCFMNSALQCMS
NTIPLTIYFLKKIYLQEINEQNVLGTQGKLAKQYAKFIKNLWTGNQRTFSPIALKMAVAR
LQSMFSGYQQHDSQEFLSYILDGLHEDLNRVKVKKYTESIDSNGRPDQVVAKESWLNHLK
RNQSIIVDLMQGQFKSKVTCPDCSKESITFDPFLTCSLPIPNKEIKVISMYLIFANNRKT
AIEVKYTYEPDQSKQQTIKDLKEYIQKTYQTSSNLILYSLTFDRVKDQFDDETPLENVRK
TFKEPQKNALMIEYDVDIHDENKMKVFFTFTRLKEEMYMARRLVKSNFTFIRPFIIEKKA
NKKDVHLALFEYLKPIFLRNSKPDSEFAIDAEKLKLDELYEKYILNVENPPYRLLVETDA
QDYIERPCTWCNQQKCKNCPVQYNDDEDPMEDFSKRSKSHYHSFRFECFVDQTTDFGRMI
NSLHSLDHSSQNNDSNTSASHNLDAKTNIYDCLKLFEQPERLGEDNEWYCPECKKHQKAQ
KQIVIYRAPDILILHLKRFKGSSGLFKSKLTKVVDFPIQGLDMTDFVIEKETPQSYYEQD
ADYFKDIHINPQKVEQNHIDESFKQSQPTQDEIDQENNKNHETNHSPSNNEEINIEEEQK
NNDSKMEQEGDNKNDKRLFYDLYAITNHYGSLGFGHYTAYAQNNNRWFCFDDSCVRDVTP
DQLVSEASYILFYKRRK
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgtctcattaagaaaatttctagggcatagaagaaggagtttcagcagctgctcctcat
tagcaccaaagcagtgagaattctatggaataagaagaacataaggataatatcgtttta
gattagggagctgcagcagctggagttattatagaagctaacaatagcggagatatggaa
gaagaaaaccatattttagaagaaggtgaataagcagacactgaaaactaaattataaat
gaagaattgaatttagaagaaaaaacctaagaataggaagctgtcaaagaacaattagta
aactaagcgttgaaatttaaagagttatgggaaaaattcaattaagattttgagtcctct
cctagcagcacttacttcgttctctcatctcattggctcagatattggaagaaacacgtt
agctacgatagagtaattaagggtaaagaacctatttatgaacatttcgcaaagcatgga
gacaaattagaaaatgctaataaagatctcatttaaacaacagttgattaaagtagtgat
taatattatgagttttcagagcttaatgaagatggctctactataattttgaagccttag
ttgtaagaaatttaagattacgctatagttgataaagatatagtcaatcttttgtcagaa
aactacttaaatttttaagttattcctagaagagctttcaagcgtcctgatggaaaaaaa
ggcatcgaaatatactatagaaaggtcaatttaattatcttgaaccatagtttgttgaag
gacatagatggaggaagagctaaatcattcacatgcaaataaatttaattgttttcaaaa
gaaaactaagaagagcttaagcatttcctagttccaattattaaaagacactaatacaat
taagcctatggataccaaaattaaccttaaaatattaatttgcaaacaatcagactttgg
aagctcaaagaaaatgacactattgaaaaggtattctagcaattatttgaagcaacaaga
agatttacaagctttgagtataaattgaaatctcctatcgtttttattgaaagaaataac
aacaacactgtagaagaacttaacatagaagaggattctaccatttttgtagaagtttaa
cgttaaaatggatggacacttaaattagaaggtgagcctgatgaagactagtgtgagttc
tgtagaaactataaagttctaaagtttgaatgcaaatgtcagaaggttaagtattgctct
gatagttgtaaatttaaagatcaagagtaccacgctagagtctgtgataaggctggagaa
gattcagaagatgaataagaataaccttacaaatttgaaaacgattctgttcgtggatta
tgcggcttatagaatcttggtaatacatgttttatgaatagtgcactttagtgtatgagc
aatacaatccctttgactatttactttttaaagaagatttacttacaagaaattaatgag
taaaatgtacttggaactcaaggtaaattggctaagtaatatgcaaagtttattaaaaat
ttgtggacaggtaattaaagaactttcagtcctatagctttaaagatggcagttgctaga
ctctaatctatgttttctggttattagcagcatgattcctaagaatttttatcttacatt
ttggacggtttgcatgaagatttaaatagagtaaaagtgaaaaaatacactgaatctatc
gattcgaatggaagacctgatcaagttgtagctaaggaatcctggttgaatcatttaaaa
agaaactaaagtattattgttgacttaatgcaaggttaattcaagtcaaaagttacttgc
cctgattgctctaaggaatctataacctttgatcctttcttaacttgctctttacctatt
cctaataaggaaataaaagtaattagcatgtatttgatatttgcaaataacaggaaaaca
gcaattgaagttaaatacacctacgaacctgaccaatcaaaataataaacaattaaagat
ctgaaagagtacatttaaaagacatactaaacttcttcaaacttaattttatactctcta
acatttgacagagttaaagatcagtttgatgacgaaactccattagaaaatgtaagaaaa
acttttaaagaaccttaaaagaatgctttgatgattgaatacgatgtggatatccatgat
gaaaataaaatgaaggtatttttcacttttactaggctgaaagaggaaatgtatatggca
agaagactagtaaagagcaatttcacatttattagaccatttatcatagaaaagaaagca
aacaagaaagatgtccacttagctcttttcgaatatttaaaacctattttcctcagaaat
tcaaaaccagattcagagtttgcaattgatgctgaaaaattaaaattagatgagctttat
gaaaagtacatcttaaatgtagaaaaccctccttacagacttttagttgaaactgatgct
caagattatattgagagaccttgcacctggtgtaactaataaaaatgtaagaactgtcct
gttcaatacaatgatgatgaagatcctatggaagatttctcaaaaagatcaaaatctcat
tatcactcttttagatttgagtgcttcgttgattaaaccacggattttggcagaatgata
aactctttacactcacttgatcacagtagttaaaataatgactccaatactagtgctagc
cataatttagatgctaaaactaacatttatgattgtttaaagctatttgagcaaccagaa
agattaggagaagataatgaatggtattgtcctgaatgcaaaaagcattagaaggcataa
aagtaaattgttatttatagagctcctgatatacttatccttcaccttaagagatttaaa
ggatctagtggtttatttaagagtaaattaacaaaagtagttgatttccctatccaaggc
cttgatatgaccgattttgtgatagaaaaagaaactccatagtcatattatgaataggat
gcagattattttaaagatattcacataaatcctcaaaaagtagaataaaatcacatagat
gaaagttttaagtagtcataacctacacaagatgaaattgattaagaaaataacaaaaat
catgaaactaatcactcaccttcaaacaacgaagaaataaacattgaagaagaataaaaa
aataatgatagtaaaatggaataggagggtgataataaaaatgataagagattgttttat
gatctctacgctattactaaccattatggtagtttaggatttggtcactacactgcatat
gcataaaataataatagatggttctgctttgatgactcctgtgtcagggatgttactcct
gattaacttgtgagcgaagcttcctacattcttttctacaaaagaagaaaatga

DBGET integrated database retrieval system