KEGG   Tetrahymena thermophila: TTHERM_00052420Help
Entry
TTHERM_00052420   CDS       T01020                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tet  Tetrahymena thermophila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TTHERM_00052420
Enzymes [BR:tet01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     TTHERM_00052420
Peptidases [BR:tet01002]
 Cysteine Peptidases
  Family C44
   TTHERM_00052420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 585 aa AA seqDB search
MCGILGIFNIVGRYEHVRKLATTLSRRLRHRGPDACGVYIYEVEPGVWNIICHERLSICD
LSDNGKQPFLLQKQDLKPVAFAANGEIYNYQEIRKKYENKYPLQGTSDCEIIGALYSEFG
GKEMWNHLEGMFGVIIYDPNTNEFFASRDHVGVIPLYWGVGKHGEVYVTSELKAIDDQCV
ELSILLPGHYLDKNKTPTQWYQPLWHDEEYFPNNQIDYKELREQLTQAVYEQLQGDAPFG
LFISGGVDSSIVAAITVRLVQEGKIDIKKRGMDKVHSFCIGLKGSPDIESSQKVAEYLGT
EHHAFIYTPEEGIDAIPDVIYHTETYNNTTIRASTPMYILARKIKALGIKYCLTGEGADE
LFGGYLYFHKAPNAEEFHRECVRKVKDLYKYDLLRANKSTMAWGLEVRPPFLHKSFVEYA
MSIDPNDKMPRNFPKNIEKYILRAAFDDKSKPYLPSEILWRQKEQFSDGVGYLWRDSITA
YCETVISDKDFSDREIIYEINTPRNKEQFWYRQCFEHHFPSKEAALTVPYALSIACSTEK
ALEWCESFKKNTDESGRAVLGIHQQSEQLKGTFNDGESAAKTVKN
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatcctcggtatattcaacattgttggtagatatgaacacgttagaaagctt
gccactaccctttctcgtagacttagacacagaggtcctgatgcctgtggtgtctacatc
tatgaagtagaacctggtgtttggaacattatttgccacgaacgtctctccatttgtgac
ttgagtgacaatggtaaatagcccttcttattacaaaagtaagacttaaagcctgttgct
tttgctgccaatggtgaaatttataactatcaagaaatcagaaagaaatacgaaaacaag
taccctctccaaggaaccagtgattgtgaaattattggtgctctttactctgaattcggt
ggtaaagaaatgtggaaccatcttgaaggtatgtttggtgttatcatctacgatcctaac
actaacgaattctttgcctcaagagaccacgttggtgttattcctctttactggggtgtt
ggtaaacacggtgaagtctacgttacttctgaattgaaggctattgatgactaatgcgta
gaattatccattttattaccaggtcattacttagataagaacaaaactcctacataatgg
tactaacctttatggcacgatgaagaatatttccctaacaattaaatcgactacaaggag
ttgagagaataattaacttaggctgtttatgaataattataaggtgatgctccttttggt
ttattcatttctggaggtgttgatagcagtatagttgcagccatcactgtccgtttagtc
taagaaggcaagatcgatatcaagaagagaggtatggataaagtccacagtttctgcatt
ggtttaaagggatcacctgatattgaatcttctcaaaaagttgctgaatacttaggaact
gaacatcatgccttcatctacactcctgaagaaggtattgatgctattcctgatgttatc
tatcacactgaaacctacaacaatacaactatccgtgcctccactcctatgtacatcctc
gctagaaagattaaagctttgggtattaagtattgcttgactggtgaaggtgctgatgaa
ctttttggtggttacttatatttccacaaagccccaaacgctgaagaattccacagagaa
tgtgtcagaaaagttaaggatctctacaaatacgatttactccgtgcaaacaaatctact
atggcttggggtttggaggttcgtcctcctttcctccacaaatcctttgttgaatatgct
atgtcaatcgatcccaacgataaaatgcctcgtaacttccctaaaaacattgaaaagtac
attcttagagctgctttcgatgataagagcaagccctacttaccctctgaaattttatgg
agacaaaaagaacaattctcagatggtgttggttatctttggagagattctattaccgct
tattgcgaaactgtcatctctgataaagacttcagtgacagagaaatcatttatgaaata
aatactcctcgtaataaagaatagttctggtatagataatgctttgaacatcatttccct
tctaaggaagctgccttaactgtcccatatgctttgagtattgcttgctcaactgaaaag
gctcttgaatggtgtgaatcattcaagaagaacactgacgaatcaggtcgtgcagttctc
ggtatccatcaacaatctgaataacttaagggcacctttaacgatggtgaaagtgctgct
aaaactgttaaaaattga

DBGET integrated database retrieval system