KEGG   Tetrahymena thermophila: TTHERM_00056090Help
Entry
TTHERM_00056090   CDS       T01020                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tet  Tetrahymena thermophila
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tet00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TTHERM_00056090
Translation factors [BR:tet03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TTHERM_00056090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 239 aa AA seqDB search
MGDWDEDWESADIKIEQAQNQFAKEDAVDTLALEKKAKEEEKKKAEEEAKKKKEEEEAKA
AKNKKKGPQKIVYTDQFNMPDTSKKLTQLKEEKRKKQDINDMFDGANHEFNEHLQNIELQ
EAEDFEVLGQLLGNKLCDPDYLNIHIEDFFKNLLQSTYEKLTSKELQEILSKTTVLLQQK
QREEKGNAKNNSKKGKGPNIGAKNVAKYKQKGSDSESNEDDEDEDNYNYKANFNEDDFI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactgggacgaagactgggaaagcgctgacattaaaattgaataagcttagaat
caatttgccaaagaagatgctgttgataccttagctcttgaaaagaaagccaaggaagaa
gaaaaaaaaaaagctgaagaagaagcaaaaaagaaaaaggaagaagaagaagctaaggct
gcaaaaaataaaaagaaaggcccttaaaaaatcgtttacactgattaattcaacatgcca
gacacttccaagaaattaacctaacttaaggaagaaaaacgtaaaaaataagatataaat
gatatgtttgacggtgccaatcacgaattcaatgaacatctttaaaatattgaattacaa
gaagctgaagattttgaagttttaggataacttctcggaaataaattatgcgatcctgat
tatcttaatatccacattgaagacttcttcaagaatctcttacaaagcacttatgaaaaa
cttacttctaaggaactctaagaaatattaagcaaaactacagtccttctatagtaaaag
caaagagaggaaaaaggaaatgctaaaaataacagtaaaaagggtaaaggtcctaacatt
ggagctaaaaatgttgctaaatacaaataaaagggatccgatagtgaatctaacgaagat
gatgaagatgaagataattataactacaaggctaactttaatgaggatgacttcatatga

DBGET integrated database retrieval system