KEGG   Tetrahymena thermophila: TTHERM_00083300Help
Entry
TTHERM_00083300   CDS       T01020                                 

Definition
Cullin family protein
Orthology
K03869  
cullin 3
Organism
tet  Tetrahymena thermophila
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:tet04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 765 aa AA seqDB search
MLHTAKVNEELYQKARELVTDVHAKVLKILKRGENVVVSNGEYMPCYNAVIKACDSSQEP
TANKDEKIQNNEERLFNWFKQLIKEYLLGDVQESNLIMDQEQYIEKVYKQYKNFQIYLHW
LSRLFYYLDQFFLKNKNSTLHVEGFKIYRDDYFQIINNKLFNHIVNFQKMAREDQSIPRE
TVKRLIQIYQEVGFKKTVKLKKIANSSEFAYEVDDGSKYYEDNFQAKFADEMEQYYLKRV
NEWSNLSTPEYVEQALKSLQKEEEIAQYFYSKSQKIIVNRIEQIVIQQQSETLANNEQTG
LYSMLKEKKENEMKNLYKLFKRVAETLDHVAKKLGQYINYHGNIFNEQSDSRKSEGVTQK
DIAVEFVQKVFALKKECDHLVQDVFNQDITIQKARDNAFQNFLNKNDKSTFFLATHADII
LKQEGLQNEQEIEDRVQEIVGIFVYFYSRDTFFKHYQKFFSNRLLNATSRNKEAEKSLIA
RFKTEAGQTGVNKIETMLKDINNSEEFNQDNRKHISPLGIELNVSVLTTGSWPIANTQEK
VSTPQVLKSSIEKFEQLYKSKYKGRNINWLYSQGTAEMQFRSKEKYLLIVNSYQMVALLS
IQSQANTISYQKLVQISGIPENELEFLLMPFVKLKILNKSDEGDAFNNNSELSINSQFQN
KLKKIKCIPGGKQAQQKKQKEDDEGRTQFMEEMNREREFIVDACIVRIMKSRKTMKHNDL
FPEVIKLINNFKPEIPLIKRRIESLLDRDYLKRDENDRNTFIYVP
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgctacacacagctaaagtcaatgaagagctgtatcaaaaagctcgtgaattagttacc
gatgtacatgcaaaagtactaaagattttaaagagaggtgagaatgttgtcgtttcaaac
ggagagtatatgccatgttataatgcagttattaaagcttgtgattcttcctaagaacca
accgcaaataaagatgaaaaaatataaaataatgaagaaaggctattcaactggtttaaa
taattgattaaggaatatttattaggtgatgtttaagaatcaaatttaattatggattaa
gagtagtatattgaaaaggtgtataaataatataaaaatttttaaatttacctccattgg
ctctcacgtctgttctactaccttgactaattctttttaaaaaacaagaattctactctc
cacgttgaaggttttaagatatacagagatgattatttttagattattaataataaacta
ttcaatcacattgtaaatttctaaaaaatggctagagaagactaatcaattcctcgtgaa
actgtaaaaagacttattcaaatatactaagaagtaggctttaaaaagactgtaaagcta
aaaaagattgcaaactcttctgagttcgcttatgaagttgacgatggctctaagtattac
gaagataatttctaagcaaagtttgcggatgagatggagcaatactatttaaaaagggta
aatgagtggagtaatttaagcactccagaatatgtagaataagctttaaaaagcctttaa
aaggaagaagaaatagcttaatacttctacagcaaatcataaaagattattgtaaataga
attgaacaaatcgttatctagcaataaagtgaaacacttgctaataatgagtaaacaggt
ttatattctatgcttaaagaaaagaaagagaatgaaatgaaaaatttatataaacttttc
aaaagagtagctgaaactcttgaccatgtagccaaaaagcttggttaatacattaactac
cacggaaatattttcaatgaataatctgatagccgtaaatcagaaggagttacataaaag
gatattgcagttgaattcgtctaaaaagtatttgctctaaagaaagaatgtgatcatttg
gtctaagatgttttcaaccaagatattaccatctaaaaagcaagagataatgctttctaa
aatttcttaaataaaaatgataaaagtactttctttcttgctactcatgctgatatcatt
ttgaaacaagaagggctttaaaatgaacaagaaatcgaagatcgtgtttaagaaattgtt
ggtatttttgtctatttctattcaagagatactttctttaaacattattaaaaattcttt
tcaaaccgtcttctaaacgctacttccagaaacaaagaagcagaaaagtcattaatagca
agattcaagactgaagcaggttagactggtgtcaataaaattgaaacaatgctgaaggat
attaataatagtgaagaattcaattaagataatagaaaacatattagtcctcttggaata
gaactaaatgttagtgtactcactacaggtagttggcctatagcaaatacctaagaaaag
gttagtacaccttaagttttaaagtctagcatagaaaagtttgaataactttataagtct
aaatacaaaggtagaaatattaattggttatatagttaaggtactgcagaaatgtaattt
agatctaaagagaaatatttgttaattgtaaactcgtattaaatggttgctttgctttca
atctaatcttaagctaatacaatcagctactaaaagttagtttaaatttcaggaattcct
gagaatgaacttgaattcttactgatgccctttgttaaattaaaaatattgaacaaaagt
gatgaaggagacgcttttaataacaattcagagctttctattaatagccaattctaaaat
aagcttaaaaaaataaaatgtattcctggtggtaaataagcccaacaaaaaaaataaaaa
gaagacgatgaaggcagaacttaatttatggaagaaatgaatagagaaagagaatttatt
gttgatgcttgcattgttagaattatgaaaagtagaaaaaccatgaaacacaatgattta
ttcccagaagttataaaattaatcaataattttaaaccagaaattcctcttataaaaaga
cgtatagaatctctgcttgatcgtgactatctcaaaagagatgaaaatgacagaaataca
tttatatacgtaccatga

DBGET integrated database retrieval system