KEGG   Tetrahymena thermophila: TTHERM_00083410Help
Entry
TTHERM_00083410   CDS       T01020                                 

Definition
Lysozyme protein (EC:3.2.1.17)
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 236 aa AA seqDB search
MNKLLIASLTILLITSFASAQKGILGFTPLYSGYSQDQYLCMRNSQNGFKYQNLVEKQIW
GYDRYHKIGQNYADNVGLSTNSIYVPCININTTDYPYFGQENQLLTFLKYFQQNHDVLKG
DFLWISIEQNQSKNCQWHNDFNVNCSVLDEIMTQVRRSAVGVDRFGIMASKQDWEALFGN
KCNKYSSFPLHYKNYDNKPNFSDWNEQKFGGWTKPSMKTYSKGKFECYIDADLTVY
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactattaattgcaagtttaactatccttttaattacttcttttgcaagtgct
taaaaaggaatcttgggatttactccattatactcaggatattcctaagattagtattta
tgcatgagaaactcttaaaacggattcaaatactaaaacctagttgaaaaatagatctgg
ggttatgatcgttaccacaaaatagggtaaaattatgctgataatgttggtttgtccact
aattctatttatgttccctgcatcaatatcaacacaactgactacccctattttggttaa
gaaaactaactcctcacattccttaaatacttccaacaaaaccacgatgttttaaaagga
gattttttgtggatttctatagagtaaaattaatctaaaaattgctagtggcataatgac
tttaatgttaattgttcagttcttgatgaaataatgacttaagttagacgctcagctgtt
ggagttgatagatttggtataatggcaagcaagtaagattgggaagccctttttggaaat
aaatgcaacaagtacagtagtttccctctccactataaaaactatgacaataaacctaat
ttcagtgattggaatgaataaaagtttggtggctggactaaaccttcaatgaaaacttac
tccaagggaaaattcgaatgctacatagatgctgatttgactgtgtattga

DBGET integrated database retrieval system