KEGG   Tetrahymena thermophila: TTHERM_00085220Help
Entry
TTHERM_00085220   CDS       T01020                                 

Definition
Protein kinase domain containing protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 621 aa AA seqDB search
MDKKLSSKNFSDWEVGDRYDLIKVVGSGSYGSVAEATDKKSGKKVAIKRLNGIFEDNVDC
KRILREIHLLRILNHPNLIRINEIIEPKDLQNFDTLYVVTEYCQSDLKKLFKSPIHLCMI
QVQTLTYNILTGIKYLHSAEVLHRDLKPANVLINEDCSVKICDFGLARSVEGNQNLRFSF
FTFSLLIGFIIYLTLLRMKMILLLLFLKYHKAMTSRSRCLNKHYSKILLKLKKNLHIEDD
LQEFILKTRIKLLNEQSSLFLKKQNKQQKSTQHSSFHDEFSQQIDDNLAILVNQENIIQD
QQQIVKAIETKKERKNKNRYFSKQNSKIKFYEKKTQRNLNNYQQASNQLLQKADRQIDQK
FLCIEGAHIYDDRNSNSPQKQQTSSQSPEKPAATSSGRPKLSKEKGINSKTTKRELTGHV
VTRWYRAPELILLEKDYTAAIDIWSIGCIFAELMNMIKENSPTFLDRSPLFPGSSCFPLS
PDRNNTVKQGGFPHSHSDQLNVIFSVLGTPNEEDMDFVTDAKAIEYLKSFKQKKRVDFKD
LFPAATPECIDFLNKTLVFNPRKRITIDAALNHPLFTPVRDIKKEVFADGSVVLPFEKEG
DMAIPRLRELFIEEIKRYHTK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaagttatcttccaagaatttttccgactgggaggttggtgatagatatgat
cttattaaggttgtaggtagtggttcttatggttctgtagctgaagctactgacaagaaa
tcaggcaagaaagttgccattaagagattgaatggtatcttcgaagacaatgttgactgc
aaacgtattcttagagaaattcacttgttacgtattttaaatcaccctaaccttattaga
atcaatgaaattattgaacctaaggacttatagaacttcgacactctttatgtcgttact
gaatattgctaatccgaccttaaaaagctcttcaagtcacctattcacttgtgcatgatc
caagtttaaacattaacctacaacattctcactggtattaaatatctccactctgctgaa
gtacttcatagagatctcaagcctgctaacgtccttatcaatgaagattgctctgtcaag
atttgtgactttggtctcgccagatctgtagaaggtaattaaaatctcagattttcattt
ttcactttctcacttttgattggctttatcatttatttaacacttttaaggatgaaaatg
atcctccttcttctatttctcaaataccataaagcaatgacttcaagaagtcgttgttta
aacaaacactactccaaaatattattaaaattaaaaaaaaatctccacattgaagatgat
ctgcaagagtttatcctaaaaactcgaatcaaattgttaaatgaataatcgagtttgttt
ctaaaaaaataaaataaacaataaaagtctacttaacatagctcatttcatgatgaattt
agctaataaatagatgataacctagcaatcttagtaaattaggaaaatataattcaagat
taataatagatagtcaaggcgatagaaacaaagaaagaaagaaaaaataaaaatagatat
ttcagcaaacaaaatagcaaaataaaattctatgaaaaaaaaacataaagaaatttaaat
aattatcagcaagcatcaaattaattattgtaaaaagcagatagatagatagattaaaaa
ttcttatgtattgaaggtgcacatatttatgatgatagaaatagcaacagccctcaaaag
taataaaccagtagccaaagccctgaaaagcctgcagctaccagcagtggaagacctaaa
ctttctaaagaaaagggaattaactctaaaaccactaagagagaattgactggccacgta
gttactcgttggtacagagctcccgaattgattcttttggaaaaagattacactgctgcc
attgatatctggagtattggttgtatcttcgctgaattgatgaatatgatcaaggaaaac
tcccccaccttcttagatagatctcctcttttccctggtagcagctgcttccccctctca
cctgatagaaacaacacagttaagtagggtggattcccccacagccacagtgattaattg
aatgtcatcttctcagtcttgggtacccctaatgaagaagatatggacttcgtcactgat
gctaaggctatcgaatatttaaagagcttcaagcaaaagaagagagtcgacttcaaggat
ttattcccagctgccacccctgaatgtattgatttcttgaacaaaacccttgtcttcaac
cctcgtaaaagaattactattgatgctgccctcaaccatcctctctttacccctgtcaga
gatatcaagaaagaagtatttgctgatggctccgttgttcttccctttgaaaaagaagga
gacatggctatacctagactccgtgaactcttcatcgaagaaatcaagcgttatcacact
aagtga

DBGET integrated database retrieval system