KEGG   Tetrahymena thermophila: TTHERM_00085220Help
Entry
TTHERM_00085220   CDS       T01020                                 

Definition
Protein kinase domain containing protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TTHERM_00085220
Protein kinases [BR:tet01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TTHERM_00085220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 621 aa AA seqDB search
MDKKLSSKNFSDWEVGDRYDLIKVVGSGSYGSVAEATDKKSGKKVAIKRLNGIFEDNVDC
KRILREIHLLRILNHPNLIRINEIIEPKDLQNFDTLYVVTEYCQSDLKKLFKSPIHLCMI
QVQTLTYNILTGIKYLHSAEVLHRDLKPANVLINEDCSVKICDFGLARSVEGNQNLRFSF
FTFSLLIGFIIYLTLLRMKMILLLLFLKYHKAMTSRSRCLNKHYSKILLKLKKNLHIEDD
LQEFILKTRIKLLNEQSSLFLKKQNKQQKSTQHSSFHDEFSQQIDDNLAILVNQENIIQD
QQQIVKAIETKKERKNKNRYFSKQNSKIKFYEKKTQRNLNNYQQASNQLLQKADRQIDQK
FLCIEGAHIYDDRNSNSPQKQQTSSQSPEKPAATSSGRPKLSKEKGINSKTTKRELTGHV
VTRWYRAPELILLEKDYTAAIDIWSIGCIFAELMNMIKENSPTFLDRSPLFPGSSCFPLS
PDRNNTVKQGGFPHSHSDQLNVIFSVLGTPNEEDMDFVTDAKAIEYLKSFKQKKRVDFKD
LFPAATPECIDFLNKTLVFNPRKRITIDAALNHPLFTPVRDIKKEVFADGSVVLPFEKEG
DMAIPRLRELFIEEIKRYHTK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaagttatcttccaagaatttttccgactgggaggttggtgatagatatgat
cttattaaggttgtaggtagtggttcttatggttctgtagctgaagctactgacaagaaa
tcaggcaagaaagttgccattaagagattgaatggtatcttcgaagacaatgttgactgc
aaacgtattcttagagaaattcacttgttacgtattttaaatcaccctaaccttattaga
atcaatgaaattattgaacctaaggacttatagaacttcgacactctttatgtcgttact
gaatattgctaatccgaccttaaaaagctcttcaagtcacctattcacttgtgcatgatc
caagtttaaacattaacctacaacattctcactggtattaaatatctccactctgctgaa
gtacttcatagagatctcaagcctgctaacgtccttatcaatgaagattgctctgtcaag
atttgtgactttggtctcgccagatctgtagaaggtaattaaaatctcagattttcattt
ttcactttctcacttttgattggctttatcatttatttaacacttttaaggatgaaaatg
atcctccttcttctatttctcaaataccataaagcaatgacttcaagaagtcgttgttta
aacaaacactactccaaaatattattaaaattaaaaaaaaatctccacattgaagatgat
ctgcaagagtttatcctaaaaactcgaatcaaattgttaaatgaataatcgagtttgttt
ctaaaaaaataaaataaacaataaaagtctacttaacatagctcatttcatgatgaattt
agctaataaatagatgataacctagcaatcttagtaaattaggaaaatataattcaagat
taataatagatagtcaaggcgatagaaacaaagaaagaaagaaaaaataaaaatagatat
ttcagcaaacaaaatagcaaaataaaattctatgaaaaaaaaacataaagaaatttaaat
aattatcagcaagcatcaaattaattattgtaaaaagcagatagatagatagattaaaaa
ttcttatgtattgaaggtgcacatatttatgatgatagaaatagcaacagccctcaaaag
taataaaccagtagccaaagccctgaaaagcctgcagctaccagcagtggaagacctaaa
ctttctaaagaaaagggaattaactctaaaaccactaagagagaattgactggccacgta
gttactcgttggtacagagctcccgaattgattcttttggaaaaagattacactgctgcc
attgatatctggagtattggttgtatcttcgctgaattgatgaatatgatcaaggaaaac
tcccccaccttcttagatagatctcctcttttccctggtagcagctgcttccccctctca
cctgatagaaacaacacagttaagtagggtggattcccccacagccacagtgattaattg
aatgtcatcttctcagtcttgggtacccctaatgaagaagatatggacttcgtcactgat
gctaaggctatcgaatatttaaagagcttcaagcaaaagaagagagtcgacttcaaggat
ttattcccagctgccacccctgaatgtattgatttcttgaacaaaacccttgtcttcaac
cctcgtaaaagaattactattgatgctgccctcaaccatcctctctttacccctgtcaga
gatatcaagaaagaagtatttgctgatggctccgttgttcttccctttgaaaaagaagga
gacatggctatacctagactccgtgaactcttcatcgaagaaatcaagcgttatcacact
aagtga

DBGET integrated database retrieval system